DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: mof and lsy-12

Sequence 1:NP_511051.1 Gene:mof FlyBaseID:FBgn0014340 Length:827 Species:Drosophila melanogaster
Sequence 2:NP_001263849.1 Gene:lsy-12 WormBaseID:WBGene00045419 Length:1585 Species:Caenorhabditis elegans

Alignment Length:896 Identity:216/897 (24%)
Similarity:342/897 (38%) Gaps:217/897 (24%)


  Fly    11 SAGHVQEQPIEEEHEPEQEPTDAYTIGGPPRTPVEDAAAELSASLD--------VSGSDQ---SA 64
            |...::.:|::.:::...:|       ||...||       ||..|        :....|   |.
 Worm    61 SLERIKREPVDTDYDDPNQP-------GPSSVPV-------SARTDHVLPIRFKIKAEPQEYDSD 111

  Fly    65 EQSLDLSGVQAEAAAESEPPAKRQHRDISPISEDSTPASSTSTSSTRSSSSSR---YDDVSEAEE 126
            |...|...||   .|..|.||      ||||.|    .|.......|.:.:::   :..||..: 
 Worm   112 EYGKDHGAVQ---IANKEVPA------ISPIEE----VSQKRRGRPRKTDAAQHLFFPHVSIKQ- 162

  Fly   127 APPEPE--------------PEQPQQQQQEEKKEDGQDQVKSPGPVELEAQEPAQPQKQKEVVDQ 177
               ||:              .:.|:.|...:..|....::    .:..|.::..:.:|:|     
 Worm   163 ---EPDDGFINFHESRCVGIAQDPEMQHLHDVNESHSSEI----AIFRETKKITERKKKK----- 215

  Fly   178 EIETEDEPSSDTVICVADINPYGSGSNIDDFVMDPDAPPNAIITEVVTIPAPLHLKGTQQLGLPL 242
               ||.|...|                            |..:||.....:  |.:..:...||:
 Worm   216 ---TEAEKLWD----------------------------NMSLTEKEVFQS--HTRRRRTTRLPI 247

  Fly   243 AAPPPPPPPPAAEQVP------ETPASPTDDGEEPPAVYLSPYIRSRYMQESTPGLPTRLAPRDP 301
            .............:||      :..|..:..|.:...|.:|..:.|   .|||....|.......
 Worm   248 IQNFEETEEGCIVEVPIPLIDLDNDAVESVTGPQHENVTVSENVLS---TESTDQEVTETKRLHD 309

  Fly   302 RQRNMPPPAVVLPIQTVLSANVEAISDDSSETSSSDDDEEEEEDEDDALTMEHDNTSRETVITTG 366
            ..|:..||.    ||...|..:....|.....||:........:...|..:.:.::   |.:|. 
 Worm   310 SSRDFNPPR----IQDTPSTVIRPEGDQKDPMSSTSSKRRNTNNSRCASLLSNPHS---TPVTR- 366

  Fly   367 DPLMQKIDISENPDKIYFIRREDGTVHRGQVLQSRTTENAAAPDEYYVHYVGLNRRLDGWVGRHR 431
              ||:.|..|||.|....:..:...:.:    :.||.....:|:        ..||.:..:....
 Worm   367 --LMRGILDSENSDNDEMLSNDQSEIAK----RPRTPRPRYSPE--------AQRRTNSRLSALT 417

  Fly   432 ISDN-ADDLGGITVLPAPPLA-------PDQPSTSRE-MLAQQAAAAAAASSERQKRAANKDYYL 487
            |..| ::||......|:...|       ||...||:: ....|:||.:..........:.:|   
 Worm   418 IDTNRSNDLNVDGSAPSSSSAASCGLSTPDPDRTSQQRRKGNQSAARSRKIKTPSPPLSQED--- 479

  Fly   488 SYCENSRYDYSDRKMTRYQKRRYDEINHVQKSHAELTATQAALEKEHESI--------------- 537
               |....|..|           |.:|.:......:......|.|||:.|               
 Worm   480 ---EPMELDSDD-----------DPVNELDNLPIVIDDPSYVLTKEHKEIFEQVKKSVSDRNEFS 530

  Fly   538 -TKIKYI------------DKLQFGNYEIDTWYFSPFPEEYGKARTLYVCEYCLKYMRFRSSYAY 589
             .:|..|            :::.||.:.:.|||.||||.|:...:.|::||:|..|.|.......
 Worm   531 PAQISEIYRSSKGEQARLPERIHFGAFIMKTWYGSPFPAEFINVKKLFICEFCFFYARSDEIMQN 595

  Fly   590 HLHECDRRRPPGREIYRKGNISIYEVNGKEESLYCQLLCLMAKLFLDHKVLYFDMDPFLFYILCE 654
            |..:|..|.|||.||||||:||::||:|:.:..|||.|||::::||:.|.:::|.:||.|||:..
 Worm   596 HAKKCMLRAPPGLEIYRKGDISVFEVDGRLQKEYCQTLCLVSRMFLESKTVFYDTEPFFFYIVTI 660

  Fly   655 TDKEGSHIVGYFSKEKKSLENYNVACILVLPPHQRKGFGKLLIAFSYELSRKEGVIGSPEKPLSD 719
            .|..|.|..|||||||...:..|::||:.||.:|..|.|:.||..||.|||||...|.||:|||:
 Worm   661 NDDIGCHFAGYFSKEKYEPDVNNLSCIMTLPCYQEMGLGRFLIDISYALSRKEKWFGGPEQPLSE 725

  Fly   720 LGRLSYRSYWAYTLLELMKTRCAPE-----QITIKELSEMSGITHDDIIYTLQSMKMIK------ 773
            |||.:|..||..|:...: .|...|     .|:||.:::.:|:...||:..:.|:...|      
 Worm   726 LGRKAYGGYWRTTIASCL-GRLKDELEFGSGISIKMIADDTGVNCHDILEVVCSLGWAKPVDPDE 789

  Fly   774 ---Y-------WKGQNVICVTSKTIQDHLQLPQFKQPKLTIDTDYLVWSPQ 814
               |       |...::|...|:.         .|:.|:..|.:.|.|.|:
 Worm   790 KNHYKLEWDVDWDMVSIILRESEA---------SKETKVQYDPECLDWVPR 831

Known Domains:


GeneSequenceDomainRegion External IDIdentity
mofNP_511051.1 Tudor-knot 382..432 CDD:288553 5/50 (10%)
NAT_SF 528..813 CDD:302625 114/334 (34%)
MOZ_SAS 599..778 CDD:280097 81/200 (41%)
lsy-12NP_001263849.1 NAT_SF 550..783 CDD:302625 97/234 (41%)
MOZ_SAS 605..786 CDD:280097 79/182 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG5027
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D629545at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.