DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: mof and d4

Sequence 1:NP_511051.1 Gene:mof FlyBaseID:FBgn0014340 Length:827 Species:Drosophila melanogaster
Sequence 2:NP_610163.1 Gene:d4 FlyBaseID:FBgn0033015 Length:497 Species:Drosophila melanogaster

Alignment Length:352 Identity:68/353 (19%)
Similarity:109/353 (31%) Gaps:110/353 (31%)


  Fly   169 QKQKEVVDQEIETEDEPSSDTVICVAD--INPYGSGSNIDDFVMDPDAPPNAIITEVVTIPAPLH 231
            :|.||::      |:..:.:|.:|:..  ..|:          :||.       |.|......|.
  Fly    29 EKYKEIL------ENSENFNTRLCIERRLRMPF----------LDPQ-------TGVAQTHCSLF 70

  Fly   232 LKGTQQLGLPLAAPPPPPPPPAAEQVPETPASPTDDGEEPPAVY-LSPYIRSRYMQESTPGLPTR 295
            :|..|::           |.....|:...|:|   ...:|...| |:|....|..|.....|...
  Fly    71 MKKKQRM-----------PGLRHGQIYTYPSS---RWRKPKRQYLLNPNQSFRAYQYREHNLQHS 121

  Fly   296 LAPRDPRQRNMPPPAVVLPIQTVLSANVE-AISDDSSETSSSDDDEEEE---------EDEDDAL 350
            .........::|...|.:|....|:.:.. |.:|.:|..:|.|:|.::.         .||.|..
  Fly   122 HHQTHQHHHHIPSSGVAVPQNPHLAESAAIAATDGNSMGASGDNDSKDSHANVEKEWFHDEMDTS 186

  Fly   351 TMEHDNTSRETVITTGDPLMQKIDISENPDKIYFIRRE--------------DGTVHRGQVLQSR 401
            ...|           ||......|...:.|:.|..|.:              :||..||:     
  Fly   187 HFHH-----------GDEFEDDFDSDNDFDESYTSRGKRKKCSRPRRTNANVEGTPKRGR----- 235

  Fly   402 TTENAAAPDEYYVHYVGLNRRLDGWVGRHRISDNADDLGGITVLPAPPLAPDQPSTSREMLAQQA 466
                          ..|.|||.:...|.   ||.....||             .|.:....|..|
  Fly   236 --------------KGGGNRRKNAVEGE---SDRKRRAGG-------------NSANTSAAAAAA 270

  Fly   467 AAAAAASSERQKRAANKDYYLSYCENS 493
            |||.|.::......|:...|.|:..::
  Fly   271 AAAVAHAACTAAAVASTGLYASHSNSA 297

Known Domains:


GeneSequenceDomainRegion External IDIdentity
mofNP_511051.1 Tudor-knot 382..432 CDD:288553 11/64 (17%)
NAT_SF 528..813 CDD:302625
MOZ_SAS 599..778 CDD:280097
d4NP_610163.1 Requiem_N 30..98 CDD:290758 19/105 (18%)
PHD1_d4 387..442 CDD:277091
PHD2_d4 444..489 CDD:277005
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C78113639
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR10615
RoundUp 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.