DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: mof and CG8677

Sequence 1:NP_511051.1 Gene:mof FlyBaseID:FBgn0014340 Length:827 Species:Drosophila melanogaster
Sequence 2:NP_001286123.1 Gene:CG8677 FlyBaseID:FBgn0026577 Length:2663 Species:Drosophila melanogaster

Alignment Length:691 Identity:147/692 (21%)
Similarity:231/692 (33%) Gaps:214/692 (31%)


  Fly     1 MSEAELEQTPSAG--HVQEQPIEEEHEPEQEPTDAYTIGGPPRTPVEDAAAELSASLDVSGSDQS 63
            :.||: |.|.|:.  |.:..|.|::.|.:.|     .:|..|...|.:...:|.:.   ...||.
  Fly   229 IGEAD-EDTSSSNSCHPKPPPPEQKEEEDDE-----EVGDEPEKTVPNLKIKLRSP---EQEDQK 284

  Fly    64 AE--QSLDLSGVQAEAAAESEPPAKRQHRDISPISEDSTPASS----------TSTSSTRSSSSS 116
            ::  :.|.:|..:..::|...|..||...|:     ||:|.:|          |...:.|....|
  Fly   285 SKKVKPLLISQAKLSSSASPAPTKKRSIEDV-----DSSPTASQEEQQKKHRPTLLDTKRIKKPS 344

  Fly   117 RYDDVSEAEEAPPEPEPEQPQQQQQEEKKEDGQDQVKSPGPVELEAQEPAQPQKQKEVVDQ---E 178
            ||:...:      |.|.|..::.::||.:||.          ||:..|      ::|.||.   :
  Fly   345 RYESTKD------EIEEESGEEDEEEEDEEDS----------ELDEGE------EEEDVDSAAAD 387

  Fly   179 IETED------EPSSDTVICVADINPYGSGSNID------DFVMDPDAPPNAIITEVVTIPAPLH 231
            ||.:|      ||..|..|.|     .|.||.:|      :.:.:.|...:..|.|.:..|. ||
  Fly   388 IEEDDDEEDTGEPIEDPTIVV-----QGQGSGLDCEAIPYNLIGNFDYEDDLEIGEAIADPM-LH 446

  Fly   232 LKGTQQLGLPLAAPPPPPPPPAAEQVPET--PASPTDDGEEPPAVYLSPYIRSRYMQESTPGLPT 294
            :.| |..|...............|....|  |.:....| ||..:.||| ::.....|:..|:..
  Fly   447 VIG-QGWGTDCLVGNGKNEASVEETSTRTSEPKATFFFG-EPGCLKLSP-MKQTSKPEAKRGIFD 508

  Fly   295 RLAPRDPRQR------NMPPPAVVLPIQTVLSANVEAISDDSSETSSSDDDEEEEEDEDDALTME 353
            .|:.......      |.||..         .:.:.....||.||:|:           .|.|:|
  Fly   509 SLSEEKTNGESEKCIVNTPPRN---------GSELTKTLGDSEETASA-----------SAATLE 553

  Fly   354 HDNTSRETVIT--TGDPLMQK--------------IDISENPDKIYFIRREDGTVHRG------- 395
            ..|..:|..:.  :.|.:.:|              |.:.|..::|...|.|...:..|       
  Fly   554 ETNICQEANVNKISDDQIKKKESVPVAKRNIQDSTISVIEKNEEISKGRTESEAIEEGVRNRTEV 618

  Fly   396 QVLQSRTTE----NAAAPDEYYVHYVGLNRRL---------------DGWVGRH-RISDNADDLG 440
            .|||:.:.|    :....|::.|. ..||...               |..|..| :||.||.|..
  Fly   619 SVLQNNSNESDNSSIQTQDQHKVP-ADLNNTKKPVTEKCVLESGTVEDKLVINHQQISTNALDTA 682

  Fly   441 GITVLPAPPLAPDQPSTSREMLAQQAAAAAAASSERQKRAANKDYYLSYCENSRYDYSDRK---- 501
            ....|.....:|.......:|.::|..|.:|..              |..|:|..|..|..    
  Fly   683 CDEKLSCETESPVPNQHDSKMKSEQETATSAKE--------------SVSESSPTDGEDETAKSK 733

  Fly   502 --MTRYQKRRYDE---INHVQK-----------------SHAELTATQAALE------KEHESIT 538
              :..|..:..|:   ||.:.|                 |.:|...|  .||      .||....
  Fly   734 CLIDPYAGKTNDKGIIINKIDKAEGVIKTLLQDDPPKDISKSETNTT--CLEINISPSAEHRISE 796

  Fly   539 KIKYIDKLQFGNY---------EIDTWYFSPFPEEYGKART 570
            |::.|:.....|.         |:|           ||:||
  Fly   797 KVQTIEPSTSQNLLFEDNGKSGEVD-----------GKSRT 826

Known Domains:


GeneSequenceDomainRegion External IDIdentity
mofNP_511051.1 Tudor-knot 382..432 CDD:288553 15/77 (19%)
NAT_SF 528..813 CDD:302625 13/59 (22%)
MOZ_SAS 599..778 CDD:280097
CG8677NP_001286123.1 Ehrlichia_rpt 770..>1243 CDD:118064 16/71 (23%)
PHD_RSF1 1373..1419 CDD:277018
Sox_C_TAD <2107..>2186 CDD:288887
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR10615
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.