DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: mof and mst1

Sequence 1:NP_511051.1 Gene:mof FlyBaseID:FBgn0014340 Length:827 Species:Drosophila melanogaster
Sequence 2:NP_594630.1 Gene:mst1 PomBaseID:SPAC637.12c Length:463 Species:Schizosaccharomyces pombe

Alignment Length:460 Identity:172/461 (37%)
Similarity:262/461 (57%) Gaps:73/461 (16%)


  Fly   388 EDGTVHRGQVL--QSRTTENAAAPDEYYVHYVGLNRRLDGWVGRHRISDNADDLGGITVLPAPPL 450
            :||...:.::|  |.||....     |||||...|:|||.|:    ..||.|...||..   || 
pombe    31 KDGEYRKAEILMIQKRTRGVV-----YYVHYNDYNKRLDEWI----TIDNIDLSKGIEY---PP- 82

  Fly   451 APDQP--------STSREMLAQQAAAAAAAS--------------------SERQKRAANKDYYL 487
             |::|        |:.|.....:..:..|.|                    |:....|.|:.  |
pombe    83 -PEKPKKAHGKGKSSKRPKAVDRRRSITAPSKTEPSTPSTEKPEPSTPSGESDHGSNAGNES--L 144

  Fly   488 SYCENSRYDYSDRKMTRYQKRRYDEINHVQKSHAELTATQAALEKEHESITKIKYIDKLQFGNYE 552
            ...|.   |:....:::.|:        |::    |..:.:.::..|| |.:|:.|:|:..|::|
pombe   145 PLLEE---DHKPESLSKEQE--------VER----LRFSGSMVQNPHE-IARIRNINKICIGDHE 193

  Fly   553 IDTWYFSPFPEEYGKARTLYVCEYCLKYMRFRSSYAYHLHECDRRRPPGREIYRKGNISIYEVNG 617
            |:.|||||:|:|:.:...:|:|.:|..|......:..|..:|..:.|||.||||...||.:|::|
pombe   194 IEPWYFSPYPKEFSEVDIVYICSFCFCYYGSERQFQRHREKCTLQHPPGNEIYRDDYISFFEIDG 258

  Fly   618 KEESLYCQLLCLMAKLFLDHKVLYFDMDPFLFYILCETDKEGSHIVGYFSKEKKSLENYNVACIL 682
            :::..:|:.:||::|||||||:||:|:||||||.:|..|:.|.|:||||||||:|.||||:||||
pombe   259 RKQRTWCRNICLLSKLFLDHKMLYYDVDPFLFYCMCRRDEYGCHLVGYFSKEKESSENYNLACIL 323

  Fly   683 VLPPHQRKGFGKLLIAFSYELSRKEGVIGSPEKPLSDLGRLSYRSYWAYTLLEL---MKTRCAPE 744
            .||.:||.|:|||||.|||||:::|...|||||||||||.:|||:|||..::.|   |:|     
pombe   324 TLPQYQRHGYGKLLIQFSYELTKREHKHGSPEKPLSDLGLISYRAYWAEQIINLVLGMRT----- 383

  Fly   745 QITIKELSEMSGITHDDIIYTLQSMKMIKYWKGQNVICVTSKTIQDHLQLPQFKQPKLTIDTDYL 809
            :.||.||:..:.:|.:|:::|||::.|:||:|||.:||::....|.:.:|...|:.:  |:.|.|
pombe   384 ETTIDELANKTSMTTNDVLHTLQALNMLKYYKGQFIICISDGIEQQYERLKNKKRRR--INGDLL 446

  Fly   810 V-WSP 813
            . |.|
pombe   447 ADWQP 451

Known Domains:


GeneSequenceDomainRegion External IDIdentity
mofNP_511051.1 Tudor-knot 382..432 CDD:288553 16/46 (35%)
NAT_SF 528..813 CDD:302625 133/289 (46%)
MOZ_SAS 599..778 CDD:280097 101/182 (55%)
mst1NP_594630.1 SAS2 16..447 CDD:227360 170/455 (37%)
Tudor-knot 21..74 CDD:288553 19/52 (37%)
NAT_SF 176..451 CDD:302625 133/283 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0001140
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_126735
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R415
TreeFam 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.