DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: mof and mst2

Sequence 1:NP_511051.1 Gene:mof FlyBaseID:FBgn0014340 Length:827 Species:Drosophila melanogaster
Sequence 2:NP_593736.1 Gene:mst2 PomBaseID:SPAC17G8.13c Length:407 Species:Schizosaccharomyces pombe

Alignment Length:333 Identity:141/334 (42%)
Similarity:201/334 (60%) Gaps:29/334 (9%)


  Fly   493 SRYDYSDRKMTRYQKRRYDEINHVQKSHAE-LTATQAALEKEHESITKIKYIDKLQFGNYEIDTW 556
            :|.:..|.::....|...|....|..|.:: :.:||  |.......|.|:|   |.||.|.|..|
pombe    57 TRLNQDDVRLFEKAKTVADRTKDVAYSFSDPILSTQ--LRTPPPQPTSIRY---LYFGTYRIKPW 116

  Fly   557 YFSPFPEEYGKARTLYVCEYCLKYMRFRSSYAYHLHECDRRRPPGREIYRKGNISIYEVNGKEES 621
            |.||:||||..|:.||:||.|||||........|..:|....|||.||||..||||:||:|:.:.
pombe   117 YTSPYPEEYSCAKNLYICESCLKYMNSDHVLQRHKMKCSWSYPPGDEIYRDKNISIFEVDGQRQP 181

  Fly   622 LYCQLLCLMAKLFLDHKVLYFDMDPFLFYILCETDKEGSHIVGYFSKEKKSLENYNVACILVLPP 686
            :|||.|||:||:||..|:||:|::|||||:|.|.|.:...::|||||||:|..:|||:|||.||.
pombe   182 IYCQNLCLLAKMFLHSKMLYYDVEPFLFYVLTEFDGQECKVIGYFSKEKRSASDYNVSCILTLPI 246

  Fly   687 HQRKGFGKLLIAFSYELSRKEGVIGSPEKPLSDLGRLSYRSYW----AYTLLELMKTRCAPEQIT 747
            :||:|:|..||.|||.|::.||.:|||||||||||.::|||||    |..|||:      ...|:
pombe   247 YQRRGYGVFLIDFSYLLTQVEGKLGSPEKPLSDLGLVTYRSYWKMRVAKALLEI------TTPIS 305

  Fly   748 IKELSEMSGITHDDIIYTLQSMKMIKY--WKGQNVICVTSKTIQD-----HLQLPQFKQPKLTID 805
            |..:::.:.:..||:|.||:|:.:.||  .|.:.|:.:....:::     :::.||...|||   
pombe   306 INAIAKSTSMVCDDVISTLESLSVFKYDPLKKKYVLQLKRDELENVYKAWNIKHPQRVNPKL--- 367

  Fly   806 TDYLVWSP 813
               |.|:|
pombe   368 ---LRWTP 372

Known Domains:


GeneSequenceDomainRegion External IDIdentity
mofNP_511051.1 Tudor-knot 382..432 CDD:288553
NAT_SF 528..813 CDD:302625 132/296 (45%)
MOZ_SAS 599..778 CDD:280097 95/185 (51%)
mst2NP_593736.1 SAS2 1..370 CDD:227360 139/330 (42%)
NAT_SF 102..372 CDD:302625 130/285 (46%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_126735
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.