DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: mof and Kat6a

Sequence 1:NP_511051.1 Gene:mof FlyBaseID:FBgn0014340 Length:827 Species:Drosophila melanogaster
Sequence 2:NP_001074618.1 Gene:Kat6a MGIID:2442415 Length:2003 Species:Mus musculus

Alignment Length:628 Identity:196/629 (31%)
Similarity:299/629 (48%) Gaps:125/629 (20%)


  Fly   272 PAVYLSPYIRSRYMQESTPGLPTRLAPRDPRQRNMPPPAV------------VLPIQTVLSANVE 324
            |.|.|.|:.:.:.:.|..|.....|..::..:...|...|            .|.....|:..|:
Mouse   189 PPVSLLPHEKDKPVAEPIPICSFCLGTKEQNREKQPEELVSCADCGNSGHPSCLKFSPELTVRVK 253

  Fly   325 AISDDSSETSSSDDDEEEEEDEDDALTMEHDNTSRETVITTGDP--------------------- 368
            |:.....|..:.....::.::.|:.|..  |:..|...:...||                     
Mouse   254 ALRWQCIECKTCSSCRDQGKNADNMLFC--DSCDRGFHMECCDPPLTRMPKGMWICQICRPRKKG 316

  Fly   369 --LMQKIDISENPDKIYFIRR--------------EDGTVHRGQVLQSRT-------------TE 404
              |:||        |...|:|              :..||.:|...:.||             ::
Mouse   317 RKLLQK--------KAAQIKRRYANPIGRPKNRLKKQNTVSKGPFSKVRTGPGRGRKRKITVSSQ 373

  Fly   405 NAAAPDEYYVHYV-GL------------NRRLDGWVGRHRISDNADDLGGITVLPAPPLAPDQPS 456
            :|::.:|.|:..: ||            |::..|.:            .|:|....|  :||...
Mouse   374 SASSSEEGYLERIDGLDFCRDSNAPLKFNKKTKGLI------------DGLTKFFTP--SPDGRK 424

  Fly   457 TSREMLAQQAAAAAAASSERQKRAA-----NKDYYLSYCEN-SRYDYSDRKMTRYQKRRYDEINH 515
            ...|::.............|:...:     |:|.:.|..|| .|...|...||......:.:|. 
Mouse   425 ARGEVVDYSEQYRIRKKGNRKSSTSDWPTDNQDGWESKQENEERLFGSQEIMTERDMELFRDIQ- 488

  Fly   516 VQKSHAELTATQAALEKEHESIT-----KIKYIDKLQFGNYEIDTWYFSPFPEEYGKARTLYVCE 575
                       :.||:|  ..:|     :::....::||.|||.|||.||:|:||.:...||:||
Mouse   489 -----------EQALQK--VGVTGPPDPQVRCPSVIEFGKYEIHTWYSSPYPQEYSRLPKLYLCE 540

  Fly   576 YCLKYMRFRSSYAYHLHECDRRRPPGREIYRKGNISIYEVNGKEESLYCQLLCLMAKLFLDHKVL 640
            :|||||:.|:....|:.:|....||..|||||.|||::||:|...::|||.|||:||||||||.|
Mouse   541 FCLKYMKSRTILQQHMKKCGWFHPPANEIYRKNNISVFEVDGNVSTIYCQNLCLLAKLFLDHKTL 605

  Fly   641 YFDMDPFLFYILCETDKEGSHIVGYFSKEKKSLENYNVACILVLPPHQRKGFGKLLIAFSYELSR 705
            |:|::|||||:|.:.|.:|.|:||||||||...:.|||:||::||.:||||:|:.||.|||.||:
Mouse   606 YYDVEPFLFYVLTQNDVKGCHLVGYFSKEKHCQQKYNVSCIMILPQYQRKGYGRFLIDFSYLLSK 670

  Fly   706 KEGVIGSPEKPLSDLGRLSYRSYWAYTLLELMKTRCAPEQITIKELSEMSGITHDDIIYTLQSMK 770
            :||..|||||||||||||||.:||...:||.:..: ..:||:||:||:::|:...||..||..::
Mouse   671 REGQAGSPEKPLSDLGRLSYMAYWKSVILECLYHQ-NDKQISIKKLSKLTGVCPQDITSTLHHLR 734

  Fly   771 MIKYWKGQNVICVTSKTIQDHLQLPQFKQPKLTIDTDYLVWSP 813
            |:.:...|.||....|.||||:...|.....:.:|.:.|.|:|
Mouse   735 MLDFRSDQFVIIRREKLIQDHMAKLQLNLRPVDVDPECLRWTP 777

Known Domains:


GeneSequenceDomainRegion External IDIdentity
mofNP_511051.1 Tudor-knot 382..432 CDD:288553 14/90 (16%)
NAT_SF 528..813 CDD:302625 140/290 (48%)
MOZ_SAS 599..778 CDD:280097 99/179 (55%)
Kat6aNP_001074618.1 Required for activation of RUNX1-1. {ECO:0000250|UniProtKB:Q92794} 1..144
Required for nuclear localization. {ECO:0000250} 52..166
H15 85..162 CDD:197772
Interaction with PML. {ECO:0000250} 144..663 145/512 (28%)
PHD1_MOZ_MORF 205..262 CDD:277090 9/57 (16%)
PHD2_KAT6A_6B 264..310 CDD:277002 6/48 (13%)
Interaction with RUNX1-1. {ECO:0000250} 312..663 125/387 (32%)
Catalytic. {ECO:0000250} 487..777 141/305 (46%)
MOZ_SAS <503..777 CDD:332306 136/275 (49%)
Mediates interaction with BRPF1, required for histone H3 acetyltransferase activity. {ECO:0000250} 506..809 137/274 (50%)
Acetyl-CoA binding. {ECO:0000250|UniProtKB:Q92794} 644..648 2/4 (50%)
Acetyl-CoA binding. {ECO:0000250|UniProtKB:Q92794} 653..659 5/6 (83%)
Interaction with PML. {ECO:0000250} 1511..1740
Interaction with RUNX1-2. {ECO:0000250} 1511..1636
Required for activation of RUNX1-2. {ECO:0000250} 1912..1947
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG5027
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D629545at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.