DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: mof and Kat7

Sequence 1:NP_511051.1 Gene:mof FlyBaseID:FBgn0014340 Length:827 Species:Drosophila melanogaster
Sequence 2:XP_006533076.1 Gene:Kat7 MGIID:2182799 Length:613 Species:Mus musculus

Alignment Length:598 Identity:195/599 (33%)
Similarity:288/599 (48%) Gaps:108/599 (18%)


  Fly   268 GEEPPAVYLSPYIRSRYMQESTPGLPTRLAPRDPRQRNMPPPAVVLPIQTVLSANVEAISDDSSE 332
            |.|.||.......||:  |:.||..|.:...|..|........||            ..||..::
Mouse    68 GTEEPAYSTRRVTRSQ--QQPTPVTPKKYPLRQTRSSGSETEQVV------------DFSDRETK 118

  Fly   333 TSSSDDDEEEEEDEDDALTMEHD------NTSRETVITTGDPLMQK-IDISENPDKIYF------ 384
            .::..|:........:|.:.|.|      |.|.:..|.....|... .|:|..|.:..|      
Mouse   119 NTADHDESPPRTPTGNAPSSESDIDISSPNVSHDESIAKDMSLKDSGSDLSHRPKRRRFHESYNF 183

  Fly   385 -----------IRREDGTVHRGQVLQSRTTENAAAPDEYYVHYVGLNRRLDGWVGRHRISDNADD 438
                       :....|...|...:......:..:.||..|.....:::::..:..||..||   
Mouse   184 NMKCPTPGCNSLGHLTGKHERHFSISGCPLYHNLSADECKVRAQSRDKQIEERMLSHRQDDN--- 245

  Fly   439 LGGITVLPAPPLAPDQPSTSREMLAQQAAAAAAASSERQKRAANKDYYLSYCENSRYDYSDRKMT 503
                                     .:.|....|.:|||.|...|...|....||       .::
Mouse   246 -------------------------NRHATRHQAPTERQLRYKEKVAELRKKRNS-------GLS 278

  Fly   504 RYQKRRYDEINHVQ-------------KSHAELTATQAALEKEHESITKIK----------YIDK 545
            :.||.:|.|  |.|             .|..:|...:.|..:..|.:.|::          .|..
Mouse   279 KEQKEKYME--HRQTYGNTREPLLENLTSEYDLDLFRRAQARASEDLEKLRLQGQITEGSNMIKT 341

  Fly   546 LQFGNYEIDTWYFSPFPEEYGKARTLYVCEYCLKYMRFRSSYAYHLHECDRRRPPGREIYRKGNI 610
            :.||.||:||||.||:||||.:...||:||:|||||:.::....|:.:|..:.|||.||||||:|
Mouse   342 IAFGRYELDTWYHSPYPEEYARLGRLYMCEFCLKYMKSQTILRRHMAKCVWKHPPGDEIYRKGSI 406

  Fly   611 SIYEVNGKEESLYCQLLCLMAKLFLDHKVLYFDMDPFLFYILCETDKEGSHIVGYFSKEKKSLEN 675
            |::||:||:..:|||.|||:||||||||.||:|::|||||::.|.|..|.|::|||||||.|..|
Mouse   407 SVFEVDGKKNKIYCQNLCLLAKLFLDHKTLYYDVEPFLFYVMTEADNTGCHLIGYFSKEKNSFLN 471

  Fly   676 YNVACILVLPPHQRKGFGKLLIAFSYELSRKEGVIGSPEKPLSDLGRLSYRSYWAYTLLELMKTR 740
            |||:|||.:|.:.|:|:||:||.|||.||:.|..:||||:||||||.:||||||...||..:. .
Mouse   472 YNVSCILTMPQYMRQGYGKMLIDFSYLLSKVEEKVGSPERPLSDLGLISYRSYWKEVLLRYLH-N 535

  Fly   741 CAPEQITIKELSEMSGITHDDIIYTLQSMKMIKYWKGQNVICVTSKTIQDHLQLPQFKQPK---- 801
            ...::|:|||:|:.:.:...||:.|||:::|:|||||::::......|.:.:.    |:.|    
Mouse   536 FQGKEISIKEISQETAVNPVDIVSTLQALQMLKYWKGKHLVLKRQDLIDEWIA----KEAKRSNS 596

  Fly   802 -LTIDTDYLVWSP 813
             .|:|...|.|:|
Mouse   597 NKTMDPSCLKWTP 609

Known Domains:


GeneSequenceDomainRegion External IDIdentity
mofNP_511051.1 Tudor-knot 382..432 CDD:288553 8/67 (12%)
NAT_SF 528..813 CDD:302625 139/300 (46%)
MOZ_SAS 599..778 CDD:280097 103/179 (58%)
Kat7XP_006533076.1 zf-C2HC 186..212 CDD:279824 2/26 (8%)
NAT_SF 331..609 CDD:302625 136/283 (48%)
MOZ_SAS 395..573 CDD:280097 103/179 (58%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG5027
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D285390at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_126735
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.