DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: mof and mys-4

Sequence 1:NP_511051.1 Gene:mof FlyBaseID:FBgn0014340 Length:827 Species:Drosophila melanogaster
Sequence 2:NP_492265.1 Gene:mys-4 WormBaseID:WBGene00007914 Length:617 Species:Caenorhabditis elegans

Alignment Length:632 Identity:165/633 (26%)
Similarity:254/633 (40%) Gaps:141/633 (22%)


  Fly   293 PTRLAPRDPRQRNMPPPAVVLPIQTVLSANVEAISDDSS-----------ETSSSDDDEEEEEDE 346
            ||..|...|..:.|.      |::|.|..:.:..|..||           :|.||.:...::...
 Worm     8 PTSKANSSPEGKAMS------PMKTQLLDDQQTPSSSSSKRKNLRKPSTDDTPSSSEPLSKKNRL 66

  Fly   347 DDALTMEHDNTSRETVITTGDPLM---------QKID------ISENPDKIYFIRREDGTVHRGQ 396
            |...|.|.|||.|...:..|:..:         ||.|      .||...| |.||:         
 Worm    67 DSTETAEEDNTRRRRTLKHGEVALPVCSFCKEDQKADDEPLKECSECKAK-YHIRK--------- 121

  Fly   397 VLQSRTTENAAAPDEYYVHYVGLNRRLDGWVGRHRISDNADDLGGITVLPA------------PP 449
            .|:.:        :|:..:.:.||:    |.....:  ..|...|....|:            ..
 Worm   122 CLRYK--------EEFATNILKLNK----WFCPRCV--ECDSCKGYIGDPSNIECTFCCRAWHGS 172

  Fly   450 LAPDQPSTSREM----------------------LAQQAAAAAAASSERQKR--AANKDYY---- 486
            .||...|.|.|.                      ::.::..:|.....:.||  ||.||..    
 Worm   173 CAPKGYSPSGEFDSDWYCIACCRVKGIKIWHTTSISHRSHPSAPVKERKTKRGGAARKDELEFEG 237

  Fly   487 ------------------------------LSYCENSRYDYSDRKMTRYQKRRYDEINHVQKS-- 519
                                          |.|...|....:.:|..:...|...:.::.::|  
 Worm   238 DIDELKDLLAKRDLTFEILNYEAGFSSKKPLPYTPTSSGKKNKKKQQKSPVREEFDYSNAERSPD 302

  Fly   520 -----HAELTATQAALEKEHESITKIKYIDKLQFGNY----EIDTWYFSPFPEEYGKARTLYVCE 575
                 .|:|...:|...:.::.........:.||.::    .....|.|.:.|....:..||.|:
 Worm   303 FPKVVRADLELFKATKSEAYQQTPIFNPHPEGQFLHFGTGKACKAIYSSAYEEPLHSSAHLYACK 367

  Fly   576 YCLKYMRFRSSYAYHLHECDRRRPPGREIYRKGNISIYEVNGKEESLYCQLLCLMAKLFLDHKVL 640
            :||.....:.....|...|:.:.|||.||||...::.:||:|..:..|||.|||::|||:..|.|
 Worm   368 FCLHTTNLKEDLIVHWDICNAKHPPGTEIYRNDGLAFFEVDGAVQKKYCQDLCLISKLFIASKTL 432

  Fly   641 YFDMDPFLFYILCETDKEGSHIVGYFSKEKKSLENYNVACILVLPPHQRKGFGKLLIAFSYELSR 705
            |.:::.|.||:|||...||..|||||||||...:|.|::|:||||..|:.|:|:|||..||||||
 Worm   433 YDEVETFKFYVLCEITTEGYVIVGYFSKEKNPSKNNNLSCLLVLPMVQKMGYGRLLIDMSYELSR 497

  Fly   706 KEGVIGSPEKPLSDLGRLSYRSYWAYTLLELMKTRCAPEQITIKELSEMSGITHDDIIYTLQSMK 770
            .|..||.||.||||||.|:||.||..:||..::.....:::.||::...:.|...||:..|....
 Worm   498 LEMRIGHPEHPLSDLGILAYRGYWRSSLLCYIREHRNYDRLNIKDMCLATRIAPVDIVNQLMLDN 562

  Fly   771 MIKYWKGQNVICVTSKTIQDHLQLPQFKQPKLTIDTDYLVWSPQTAA 817
            ||....|...|.:..:.    |:.|..:..:..:|...|.|.|:.:|
 Worm   563 MIVLKGGVYSIKIGKRA----LKFPLSQCRRRFVDPSQLFWKPKPSA 605

Known Domains:


GeneSequenceDomainRegion External IDIdentity
mofNP_511051.1 Tudor-knot 382..432 CDD:288553 8/50 (16%)
NAT_SF 528..813 CDD:302625 104/289 (36%)
MOZ_SAS 599..778 CDD:280097 85/179 (47%)
mys-4NP_492265.1 PLN00058 35..117 CDD:177689 20/83 (24%)
PHD 92..144 CDD:214584 14/74 (19%)
PHD 147..193 CDD:214584 8/46 (17%)
NAT_SF 347..603 CDD:302625 102/260 (39%)
MOZ_SAS 391..565 CDD:280097 84/174 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG5027
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 227 1.000 Inparanoid score I2186
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D629545at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.960

Return to query results.
Submit another query.