DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: mof and trim69.1

Sequence 1:NP_511051.1 Gene:mof FlyBaseID:FBgn0014340 Length:827 Species:Drosophila melanogaster
Sequence 2:XP_002937994.1 Gene:trim69.1 XenbaseID:XB-GENE-6462279 Length:644 Species:Xenopus tropicalis

Alignment Length:146 Identity:38/147 (26%)
Similarity:68/147 (46%) Gaps:19/147 (13%)


  Fly   342 EEEDEDDALTMEHDNTSRETVITTGDPLMQKIDISE--------NPDKIYFIRREDGTVHRGQVL 398
            |.|.::|.:..|.|:...::  |.||.....:::..        |....|..::.||::|..:|:
 Frog     8 EPEKKEDMVCEEADSNQEDS--TAGDEADGSVNVQNKAEEDEAVNVGSTYQCKKADGSLHDAEVV 70

  Fly   399 QSRTTENAAAPDEYYVHYVGLNRRLDGWVGRHRISDNADDLGGITVLPAPPLAPDQPSTSREMLA 463
            ::|..:. ...:||||||:|||||.:.||.:.|:.        :|...|...|.|:.|.:.:.:.
 Frog    71 KTRINKQ-LGKEEYYVHYIGLNRRQNEWVDKTRLV--------LTKAEAKEEAKDEASGNDQEIT 126

  Fly   464 QQAAAAAAASSERQKR 479
            .....|...:.:.|||
 Frog   127 DAVEPANGKTPQGQKR 142

Known Domains:


GeneSequenceDomainRegion External IDIdentity
mofNP_511051.1 Tudor-knot 382..432 CDD:288553 20/50 (40%)
NAT_SF 528..813 CDD:302625
MOZ_SAS 599..778 CDD:280097
trim69.1XP_002937994.1 Tudor-knot 49..105 CDD:288553 21/65 (32%)
RING 179..223 CDD:238093
zf-B_box 258..295 CDD:279037
iSH2_PI3K_IA_R 305..422 CDD:304922
SPRY_PRY_C-I_1 472..641 CDD:293968
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG5027
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.