DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: mof and xnf7

Sequence 1:NP_511051.1 Gene:mof FlyBaseID:FBgn0014340 Length:827 Species:Drosophila melanogaster
Sequence 2:NP_001165007.1 Gene:xnf7 XenbaseID:XB-GENE-6462269 Length:648 Species:Xenopus tropicalis

Alignment Length:594 Identity:118/595 (20%)
Similarity:195/595 (33%) Gaps:220/595 (37%)


  Fly   297 APRDPRQRNMPPPAVVLPIQTVLSANVEAISDDSSETSSSDDDEEEEEDE--DDALTMEHDNTSR 359
            |..:|.::::|             |..|...::..::.:.|::||:.|||  ||.     |....
 Frog     8 AASEPAKQDVP-------------AGEEGAGNNVEDSVAGDEEEEDMEDEGADDG-----DQGDE 54

  Fly   360 ETVITTGDPLMQKIDISENPDKIYFIRREDGTVHRGQVLQSRTTENAAAPDEYYVHYVGLNRRLD 424
            |.::.             |....|..:|.||:.|..:::::|..:.|.. :||||||||||||.:
 Frog    55 EVLVV-------------NVGSTYPCKRADGSQHDAEIVKTRYNKQAGR-EEYYVHYVGLNRRQN 105

  Fly   425 GWVGRHRISDNADDLGGITVLPAPPLAPDQPSTSREMLAQQAAAAAAASSERQKRAANKDYYLSY 489
            .||.:.|:           ||..||...:...|.:|                             
 Frog   106 EWVDKSRL-----------VLTKPPKEGETNGTDQE----------------------------- 130

  Fly   490 CENSRYDYSDRKMTRYQKRRYDE-------INHVQKSHAELTATQAALEKEHESITKIKYIDKLQ 547
             |.:..:..|.|..  |||:.:|       ....:|..::..:|..|.....|.:|         
 Frog   131 -ETNSTEQPDSKTP--QKRKLEEPEPEPKKAKVEEKDASKNASTLGAAGDFAEELT--------- 183

  Fly   548 FGNYEIDTWYFSPFPEEYGKARTLYVCEY-----CL-KYMRFRSSYAYHLHEC-----DRRRPPG 601
                       .|...|..|...:..|.:     |: |....:||:|  ..||     ||:    
 Frog   184 -----------CPLCMELFKDPVMVACGHNFCRSCIDKAWEGQSSFA--CPECKESITDRK---- 231

  Fly   602 REIYRKGNISIYEVNGKEESLYCQLLCLMAKLFLDHKV--------------LYFDMDPFLFYIL 652
                       |.:|....:|..:.:|......::.|.              ||...|..|..::
 Frog   232 -----------YTINRVLANLVKKAVCATPVTPVEKKTQPLEKCSEHDERLKLYCKDDGTLGCVI 285

  Fly   653 C-ETDKEGSH-------IVGYFSKE-----------------------------KKSLENYNVAC 680
            | ::.|..||       .||.:.:|                             .|::..|.   
 Frog   286 CRDSLKHASHNFLPILDAVGVYREELSAIVAPLEASLKVTEQLSSEQSEKIDQHNKNMSQYK--- 347

  Fly   681 ILVLPPHQRKGFGKLLIAFSYELSRKEGVIGSPEKPLSDLGRLSYRSYWAYTLLELMK---TRCA 742
                 .|....|.| |.||..|  |:|.::    :.|.:.|.         :||:.|:   .:..
 Frog   348 -----EHITSEFEK-LHAFLRE--REEKLL----EQLKEQGE---------SLLKEMENNLVKMQ 391

  Fly   743 PEQITIKELSEMSG--ITHDDIIYTLQSMKMI--KYWKGQNVICVTSKT-IQDHLQLPQFKQPKL 802
            ..|..||:...::.  :...|.|..|..:|..  |..:.|..:..|..| :...|....||.|  
 Frog   392 ENQDAIKKTITLANERMEDTDSISFLMDIKTFIDKCQEQQRAVVSTGNTLLSKELCQGTFKGP-- 454

  Fly   803 TIDTDYLVW 811
               ..|::|
 Frog   455 ---IQYIMW 460

Known Domains:


GeneSequenceDomainRegion External IDIdentity
mofNP_511051.1 Tudor-knot 382..432 CDD:288553 22/50 (44%)
NAT_SF 528..813 CDD:302625 65/355 (18%)
MOZ_SAS 599..778 CDD:280097 40/237 (17%)
xnf7NP_001165007.1 Tudor-knot 59..115 CDD:288553 24/81 (30%)
NAT_SF 93..>193 CDD:302625 35/163 (21%)
zf-C3HC4_4 184..223 CDD:291880 10/41 (24%)
BBOX 259..300 CDD:197662 8/41 (20%)
iSH2_PI3K_IA_R 313..433 CDD:304922 25/144 (17%)
SPRY_PRY_C-I_1 476..644 CDD:293968
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG5027
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.