DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosbeta2R1 and hslV

DIOPT Version :10

Sequence 1:NP_572267.1 Gene:Prosbeta2R1 / 31511 FlyBaseID:FBgn0029812 Length:307 Species:Drosophila melanogaster
Sequence 2:NP_418367.1 Gene:hslV / 948429 ECOCYCID:EG11676 Length:176 Species:Escherichia coli


Alignment Length:200 Identity:46/200 - (23%)
Similarity:76/200 - (38%) Gaps:59/200 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 TSIVGIIYKDGVILGADTRATEGPIVSDKNCSKIHHL-QDHIYCCGAGTAADTEMITLTTSAELD 112
            |:||.:.....|::..|.:||.|..|...|..|:..| .|.:....||..||...:......:|:
E. coli     2 TTIVSVRRNGHVVIAGDGQATLGNTVMKGNVKKVRRLYNDKVIAGFAGGTADAFTLFELFERKLE 66

  Fly   113 LHR-------------LNTERRVPVVCASMMLRR--TLFRYQGHIGAALVMGGVDTTGPQLYCIY 162
            :|:             ..|:|         |||:  .|........:.::.|..|...|:     
E. coli    67 MHQGHLVKAAVELAKDWRTDR---------MLRKLEALLAVADETASLIITGNGDVVQPE----- 117

  Fly   163 PCGSNDKIPYAAMGSG----TLAAMSVLEHGWKPDLDLEQGKQLVREAIS-AGVFNDLGSGSNID 222
                ||.|   |:|||    ..||.::||     :.:| ..:::..:|:. ||           |
E. coli   118 ----NDLI---AIGSGGPYAQAAARALLE-----NTEL-SAREIAEKALDIAG-----------D 158

  Fly   223 LCVIT 227
            :|:.|
E. coli   159 ICIYT 163

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosbeta2R1NP_572267.1 proteasome_beta_type_7 49..236 CDD:239732 45/199 (23%)
Pr_beta_C 240..274 CDD:463597
hslVNP_418367.1 PRK05456 1..172 CDD:235477 45/199 (23%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.