DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosbeta2R1 and PBA1

DIOPT Version :10

Sequence 1:NP_572267.1 Gene:Prosbeta2R1 / 31511 FlyBaseID:FBgn0029812 Length:307 Species:Drosophila melanogaster
Sequence 2:NP_001031759.1 Gene:PBA1 / 829257 AraportID:AT4G31300 Length:234 Species:Arabidopsis thaliana


Alignment Length:185 Identity:55/185 - (29%)
Similarity:101/185 - (54%) Gaps:2/185 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 GTSIVGIIYKDGVILGADTRATEGPIVSDKNCSKIHHLQDHIYCCGAGTAADTEMITLTTSAELD 112
            ||:|:|:.|..||:||||:|.:.|..|:::...||..|.|::|.|.:|:|||:::::......|.
plant    12 GTTIIGVTYNGGVVLGADSRTSTGMYVANRASDKITQLTDNVYVCRSGSAADSQVVSDYVRYFLH 76

  Fly   113 LHRLNTERRVPVVCASMMLRRTLF-RYQGHIGAALVMGGVDT-TGPQLYCIYPCGSNDKIPYAAM 175
            .|.:...:...|..::.::|...: ..|..:...|::||.|. .|.::|.|...|:..:.|:|..
plant    77 QHTIQHGQPATVKVSANLIRMLAYNNKQNMLQTGLIVGGWDKYEGGKIYGIPLGGTVVEQPFAIG 141

  Fly   176 GSGTLAAMSVLEHGWKPDLDLEQGKQLVREAISAGVFNDLGSGSNIDLCVITAKG 230
            |||:.......:..||.::..|:.:|||.:|:|..:..|..||..:...:|.::|
plant   142 GSGSSYLYGFFDQAWKDNMTKEEAEQLVVKAVSLAIARDGASGGVVRTVIINSEG 196

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosbeta2R1NP_572267.1 proteasome_beta_type_7 49..236 CDD:239732 54/184 (29%)
Pr_beta_C 240..274 CDD:463597
PBA1NP_001031759.1 proteasome_beta_type_6 13..201 CDD:239731 54/184 (29%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.