DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosbeta2R1 and PAD1

DIOPT Version :10

Sequence 1:NP_572267.1 Gene:Prosbeta2R1 / 31511 FlyBaseID:FBgn0029812 Length:307 Species:Drosophila melanogaster
Sequence 2:NP_190694.1 Gene:PAD1 / 824289 AraportID:AT3G51260 Length:250 Species:Arabidopsis thaliana


Alignment Length:201 Identity:53/201 - (26%)
Similarity:86/201 - (42%) Gaps:20/201 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 KAIKTGTSIVGIIYKDGVILGADTRATEGPIVSD-KNCSKIHHLQDHIYCCGAGTAADTEMITLT 106
            :|::.|.:.||:...|.|:|..:.::|  |.:.| ::..||..|.:||....||..||..::...
plant    25 EAVRKGNAAVGVRGTDTVVLAVEKKST--PKLQDSRSARKIVSLDNHIALACAGLKADARVLINK 87

  Fly   107 TSAELDLHRLNTERRVPVVCASMMLRRTLFRY--QGHI---GAALVMGGVD--TTGPQLYCIYPC 164
            ...|...|||..|..|.|...:..:.....:|  .|.:   |.:.::.|.|  |..|.||...|.
plant    88 ARIECQSHRLTLEDPVTVEYITRYIAGLQQKYTQSGGVRPFGLSTLIVGFDPYTRIPALYQTDPS 152

  Fly   165 GSNDKIPYAAMGSGTLAAMSVLEHGWKPDLDLEQGKQLVR---EAISAGVFNDLGSGSNIDLCVI 226
            |:.......|.|..:.:....||..:|.....|..|..:|   |.:.:|       |.||::.|:
plant   153 GTFSAWKANATGRNSNSIREFLEKNYKESAGQETVKLAIRALLEVVESG-------GKNIEVAVM 210

  Fly   227 TAKGAV 232
            |.:..|
plant   211 TREEGV 216

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosbeta2R1NP_572267.1 proteasome_beta_type_7 49..236 CDD:239732 51/195 (26%)
Pr_beta_C 240..274 CDD:463597
PAD1NP_190694.1 proteasome_alpha_type_7 4..210 CDD:239724 50/193 (26%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.