DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosbeta2R1 and PAG1

DIOPT Version :10

Sequence 1:NP_572267.1 Gene:Prosbeta2R1 / 31511 FlyBaseID:FBgn0029812 Length:307 Species:Drosophila melanogaster
Sequence 2:NP_001323455.1 Gene:PAG1 / 817244 AraportID:AT2G27020 Length:351 Species:Arabidopsis thaliana


Alignment Length:150 Identity:46/150 - (30%)
Similarity:70/150 - (46%) Gaps:6/150 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 KAIKTGTSIVGIIYKDGVILGADTRATEGPIVSDKNCSKIHHLQDHIYCCGAGTAADTEMITLTT 107
            ||:....::|||..|||:::|.:.......::...| .:||.:..|.....||.|||...|....
plant   131 KAVDNSGTVVGIKCKDGIVMGVEKLIASKMMLPGSN-RRIHSVHRHAGMAVAGLAADGRQIVARA 194

  Fly   108 SAELDLHRLNTERRVPVV-----CASMMLRRTLFRYQGHIGAALVMGGVDTTGPQLYCIYPCGSN 167
            .:|...:.......|||.     .||.:...||:.:....|..:::||.|..|||||.|.|.|.:
plant   195 KSEARSYESVYGDAVPVKELSERVASYVHLCTLYWWLRPFGCGVILGGYDRDGPQLYMIEPSGIS 259

  Fly   168 DKIPYAAMGSGTLAAMSVLE 187
            .:...||:|.|..||.:.:|
plant   260 YRYFGAAIGKGKQAAKTEIE 279

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosbeta2R1NP_572267.1 proteasome_beta_type_7 49..236 CDD:239732 43/143 (30%)
Pr_beta_C 240..274 CDD:463597
PAG1NP_001323455.1 proteasome_alpha_type_3 107..318 CDD:239720 45/149 (30%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.