DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosbeta2R1 and Prosbeta1

DIOPT Version :10

Sequence 1:NP_572267.1 Gene:Prosbeta2R1 / 31511 FlyBaseID:FBgn0029812 Length:307 Species:Drosophila melanogaster
Sequence 2:NP_652031.2 Gene:Prosbeta1 / 46058 FlyBaseID:FBgn0010590 Length:224 Species:Drosophila melanogaster


Alignment Length:185 Identity:35/185 - (18%)
Similarity:60/185 - (32%) Gaps:74/185 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 DTAQPWMMSSYHPSTTSDVFWTTTPSSTSTTPSSDNGIQQYSSISTSSGYAPANSPAK-TAEVNQ 67
            |:|.|:  |...|:.|:.|.|                 .||.:..|..|    |:|.: |...:.
  Fly   371 DSALPY--SENEPTATACVNW-----------------NQYYTNCTQLG----NNPFQGTISFDN 412

  Fly    68 LGGVFVNGRPLPFEMRCKIVELSRQGTRPCDISRQLKISHG---------------------CVS 111
            :|..:|          ...:.:|.:|.  .||...::.:|.                     |:.
  Fly   413 IGLAWV----------AIFLVISLEGW--TDIMYYVQDAHSFWDWIYFVLLIVIGSFFMINLCLV 465

  Fly   112 KILTRFSE-----------------NGTIMPGTIGGSRPRVTTPKVVEYIRSLKR 149
            .|.|:|||                 :.:.:..:...|.|.....::|:||..|.|
  Fly   466 VIATQFSETKKREMERMRQERARFTSSSTLASSTNNSEPTTCYAEIVKYIGHLYR 520

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosbeta2R1NP_572267.1 proteasome_beta_type_7 49..236 CDD:239732 25/140 (18%)
Pr_beta_C 240..274 CDD:463597
Prosbeta1NP_652031.2 proteasome_beta_type_6 16..203 CDD:239731
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.