DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosbeta2R1 and Prosalpha4T1

DIOPT Version :10

Sequence 1:NP_572267.1 Gene:Prosbeta2R1 / 31511 FlyBaseID:FBgn0029812 Length:307 Species:Drosophila melanogaster
Sequence 2:NP_650910.1 Gene:Prosalpha4T1 / 42457 FlyBaseID:FBgn0265606 Length:249 Species:Drosophila melanogaster


Alignment Length:145 Identity:37/145 - (25%)
Similarity:68/145 - (46%) Gaps:9/145 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 KAIKTGTSIVGIIYKDGVILGADTRATEGPIVSDKNCSKIHHLQDHIYCCGAGTAADTEMITLTT 107
            :|::.|::.||:...:.|:||.: :::...:..|:...||..|..|:....||..||..::....
  Fly    26 EAVRKGSTAVGVRGANCVVLGVE-KSSVSEMQEDRTVRKISMLDRHVALAFAGLTADARILINRG 89

  Fly   108 SAELDLHRLNTERRVPVVCASMMLRRTLFRY-----QGHIGAALVMGGVDTTG-PQLYCIYPCGS 166
            ..|...||||.|.:|.:...:..|.:...:|     :...|.:.::||:|..| .:|:...|.|.
  Fly    90 QVECQSHRLNFENQVTLEYITRYLAQLKQKYTQCNGRRPFGISCLIGGIDADGSARLFHTEPSGI 154

  Fly   167 NDKIPYAAMGSGTLA 181
            ..:  |.|..:|..|
  Fly   155 FHE--YKATATGRWA 167

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosbeta2R1NP_572267.1 proteasome_beta_type_7 49..236 CDD:239732 35/139 (25%)
Pr_beta_C 240..274 CDD:463597
Prosalpha4T1NP_650910.1 proteasome_alpha_type_7 5..213 CDD:239724 37/145 (26%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.