DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosbeta2R1 and yip3

DIOPT Version :10

Sequence 1:NP_572267.1 Gene:Prosbeta2R1 / 31511 FlyBaseID:FBgn0029812 Length:307 Species:Drosophila melanogaster
Sequence 2:NP_523819.2 Gene:yip3 / 37683 FlyBaseID:FBgn0040063 Length:193 Species:Drosophila melanogaster


Alignment Length:47 Identity:10/47 - (21%)
Similarity:16/47 - (34%) Gaps:11/47 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 NCDTAQPW-MMSSYHPSTTSDVF----------WTTTPSSTSTTPSS 37
            :|....|| :.|::.|.....|.          |...|..::|...|
  Fly   101 SCAKVHPWTIKSTWFPGYAWKVCVCPKCHTLLGWMFEPVESATAEQS 147

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosbeta2R1NP_572267.1 proteasome_beta_type_7 49..236 CDD:239732
Pr_beta_C 240..274 CDD:463597
yip3NP_523819.2 Ntn_hydrolase 14..155 CDD:469781 10/47 (21%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.