DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr5C and Lcp65Ae

DIOPT Version :10

Sequence 1:NP_572266.1 Gene:Cpr5C / 31510 FlyBaseID:FBgn0029811 Length:145 Species:Drosophila melanogaster
Sequence 2:NP_788468.1 Gene:Lcp65Ae / 45018 FlyBaseID:FBgn0020640 Length:99 Species:Drosophila melanogaster


Alignment Length:82 Identity:24/82 - (29%)
Similarity:40/82 - (48%) Gaps:12/82 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 VAQPVLAKADE------EYDPHPQ-YKYAYDVQDAISGDSKSQVEERDGD----VVRGEYSLVDS 99
            ||....|.|:|      |.|..|: ::::::..|..:.::|.|::..:.|    .|:|.:..|..
  Fly     8 VAIFAFALANEAQIINLESDVGPENFQWSFETSDGQAANAKGQLKYPNTDHESLAVQGSFRFVAD 72

  Fly   100 DGFKRTVQYTADPINGF 116
            ||....|.|.||. |||
  Fly    73 DGQTYEVNYIADE-NGF 88

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr5CNP_572266.1 Chitin_bind_4 64..116 CDD:459790 14/55 (25%)
Lcp65AeNP_788468.1 Chitin_bind_4 33..88 CDD:459790 14/55 (25%)

Return to query results.
Submit another query.