DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr5C and Lcp65Af

DIOPT Version :10

Sequence 1:NP_572266.1 Gene:Cpr5C / 31510 FlyBaseID:FBgn0029811 Length:145 Species:Drosophila melanogaster
Sequence 2:NP_477274.1 Gene:Lcp65Af / 45017 FlyBaseID:FBgn0020639 Length:100 Species:Drosophila melanogaster


Alignment Length:104 Identity:34/104 - (32%)
Similarity:46/104 - (44%) Gaps:22/104 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 VAQPVLAKAD-----EEYDPHP-QYKYAYDVQDAISGDSKSQVEERDGDV----VRGEYSLVDSD 100
            ||...||.||     :|.|..| .:.|.|:..|..|..:..|::....|.    |:|.||.|..|
  Fly     8 VALFALAVADVQILKQESDVGPVSFNYGYETSDGSSAQAAGQLKNVGTDEEALNVKGTYSFVADD 72

  Fly   101 GFKRTVQYTADPINGFNAVVNREPLVKTVVKTVAPVAPV 139
            |...::.||||. ||:      :|....:     |||||
  Fly    73 GQTYSIAYTADE-NGY------QPQGAHL-----PVAPV 99

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr5CNP_572266.1 Chitin_bind_4 64..116 CDD:459790 18/55 (33%)
Lcp65AfNP_477274.1 Chitin_bind_4 32..87 CDD:459790 18/55 (33%)

Return to query results.
Submit another query.