DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr5C and Cpr100A

DIOPT Version :10

Sequence 1:NP_572266.1 Gene:Cpr5C / 31510 FlyBaseID:FBgn0029811 Length:145 Species:Drosophila melanogaster
Sequence 2:NP_651829.1 Gene:Cpr100A / 43657 FlyBaseID:FBgn0039805 Length:241 Species:Drosophila melanogaster


Alignment Length:138 Identity:43/138 - (31%)
Similarity:61/138 - (44%) Gaps:39/138 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 FKFVALLALIAAASAGVLPAGQLYHAAPVATYAAPAPAAVLKTVAQPVLAKADEEY-DPHPQYKY 66
            |:|:||..|:|.||:      |.||       ..|..||::          :::.| ....::..
  Fly     2 FRFLALTTLVALASS------QHYH-------QDPKTAAII----------SEQRYLSGDGKFGA 43

  Fly    67 AYDVQDAISGDSKSQVEERDGDVVR-GEYSLVDSDGFKRTVQYTADPINGFNAVVNREPLVKTVV 130
            ||:.:|.|:..     ||.|.|..| |.||.:|..|.:||:.|||.. |||.|..:..|      
  Fly    44 AYEQEDGINFK-----EETDADGTRHGSYSYLDPTGQRRTISYTAGK-NGFQASGDHLP------ 96

  Fly   131 KTVAPVAP 138
              .||.||
  Fly    97 --QAPPAP 102

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr5CNP_572266.1 Chitin_bind_4 64..116 CDD:459790 20/52 (38%)
Cpr100ANP_651829.1 Chitin_bind_4 44..88 CDD:459790 20/49 (41%)

Return to query results.
Submit another query.