DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr5C and Cpr92A

DIOPT Version :10

Sequence 1:NP_572266.1 Gene:Cpr5C / 31510 FlyBaseID:FBgn0029811 Length:145 Species:Drosophila melanogaster
Sequence 2:NP_650813.2 Gene:Cpr92A / 42333 FlyBaseID:FBgn0038714 Length:245 Species:Drosophila melanogaster


Alignment Length:163 Identity:70/163 - (42%)
Similarity:82/163 - (50%) Gaps:36/163 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 KFVALLALIAAASAGVLPAGQLY------------------HAAPVATYAAPAPAAVLKTVAQPV 50
            |...|.|::..|.|||:..|..|                  |......|.||.||          
  Fly     3 KISLLSAMLGIAYAGVIGPGPYYGGPAGPGPLHHYGGYAPQHGPLPGPYVAPKPA---------- 57

  Fly    51 LAKADEEYDPHPQYKYAYDVQDAISGDSKSQVEERDGDVVRGEYSLVDSDGFKRTVQYTADPING 115
               |.|.|||.|:|.:.||:||..:||.|||.|.|.||||:|.||:||.||.||||.|||||.:|
  Fly    58 ---APEPYDPDPKYSFGYDIQDGYTGDLKSQHETRHGDVVKGSYSVVDPDGTKRTVDYTADPHHG 119

  Fly   116 FNAVVNREPLVKTVVKTVAPV-----APVYAAY 143
            |||||.:|||.......:|||     |||.|.|
  Fly   120 FNAVVRKEPLAYKAPAHLAPVVAPAPAPVPAHY 152

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr5CNP_572266.1 Chitin_bind_4 64..116 CDD:459790 32/51 (63%)
Cpr92ANP_650813.2 Chitin_bind_4 68..120 CDD:459790 32/51 (63%)

Return to query results.
Submit another query.