DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr5C and Ccp84Aa

DIOPT Version :10

Sequence 1:NP_572266.1 Gene:Cpr5C / 31510 FlyBaseID:FBgn0029811 Length:145 Species:Drosophila melanogaster
Sequence 2:NP_649683.1 Gene:Ccp84Aa / 40825 FlyBaseID:FBgn0004783 Length:205 Species:Drosophila melanogaster


Alignment Length:150 Identity:102/150 - (68%)
Similarity:114/150 - (76%) Gaps:13/150 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAFKFVALLALIAAASAGVLP--AGQLYHAAP-VATYAAPAPAAVLKTVAQPVLAKADEEYDPHP 62
            ||||||..||.:|.||||..|  |.|:||||| |||| |.||.|    |||.|:.||.|||||||
  Fly     1 MAFKFVFALAFVAVASAGYAPIAAPQVYHAAPAVATY-AHAPVA----VAQKVVVKAAEEYDPHP 60

  Fly    63 QYKYAYDVQDAISGDSKSQVEERDGDVVRGEYSLVDSDGFKRTVQYTADPINGFNAVVNREPLVK 127
            ||:::|.|.|.::||:|.||||||||||||||||:|:||:||.||||||||||||||||||||||
  Fly    61 QYRFSYGVDDKLTGDNKGQVEERDGDVVRGEYSLIDADGYKRIVQYTADPINGFNAVVNREPLVK 125

  Fly   128 T-----VVKTVAPVAPVYAA 142
            .     ||||||.....|||
  Fly   126 AVAVAPVVKTVAAPVAQYAA 145

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr5CNP_572266.1 Chitin_bind_4 64..116 CDD:459790 37/51 (73%)
Ccp84AaNP_649683.1 Chitin_bind_4 62..114 CDD:459790 37/51 (73%)

Return to query results.
Submit another query.