DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr5C and Cpr76Bd

DIOPT Version :10

Sequence 1:NP_572266.1 Gene:Cpr5C / 31510 FlyBaseID:FBgn0029811 Length:145 Species:Drosophila melanogaster
Sequence 2:NP_001262052.1 Gene:Cpr76Bd / 40123 FlyBaseID:FBgn0036881 Length:1231 Species:Drosophila melanogaster


Alignment Length:129 Identity:60/129 - (46%)
Similarity:72/129 - (55%) Gaps:19/129 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 GVLPAGQLYHA---------APVA--TYAAPAPA---AVLKTVAQPVLAKADEEYDPHPQYKYAY 68
            |.|.||...:|         ||||  .|...||.   ||||.|.:..|    |.:|.||:|.:.|
  Fly  1100 GPLGAGFYRYAPSVPALSSHAPVAATAYLKSAPVTQHAVLKVVPEKHL----EHFDAHPRYAFEY 1160

  Fly    69 DVQDAISGDSKSQVEERDGDVVRGEYSLVDSDGFKRTVQYTADPINGFNA-VVNREPLVKTVVK 131
            .|.|..:||:|.|.||||||||:||||||:.||..|||:|.||...||:| |:|.....|.|.|
  Fly  1161 AVNDPHTGDNKHQKEERDGDVVKGEYSLVEPDGNVRTVKYYADWETGFHAEVINSRDQGKIVAK 1224

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr5CNP_572266.1 Chitin_bind_4 64..116 CDD:459790 30/51 (59%)
Cpr76BdNP_001262052.1 2A1904 130..>270 CDD:273344
PRK07003 <456..>610 CDD:235906
Chitin_bind_4 1156..1208 CDD:459790 30/51 (59%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.