DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr5C and Cpr65Ec

DIOPT Version :10

Sequence 1:NP_572266.1 Gene:Cpr5C / 31510 FlyBaseID:FBgn0029811 Length:145 Species:Drosophila melanogaster
Sequence 2:NP_648077.1 Gene:Cpr65Ec / 38775 FlyBaseID:FBgn0035737 Length:127 Species:Drosophila melanogaster


Alignment Length:85 Identity:21/85 - (24%)
Similarity:36/85 - (42%) Gaps:11/85 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 KADEEYDPHPQYKYAYDVQDAISGDSKSQVEERDGDVVRGEYSLVDSDGFKRTVQYTADPINGFN 117
            |:|.:.|  ..|.|.|...:.|:|    |.....|....|..:....||....:.||||. ||::
  Fly    32 KSDLKED--GSYAYQYQTSNGIAG----QESGVGGYYASGSNAYYAPDGQLIQLTYTADS-NGYH 89

  Fly   118 A----VVNREPLVKTVVKTV 133
            .    :....|:..:::|::
  Fly    90 PAGAHLPTPPPIPASILKSL 109

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr5CNP_572266.1 Chitin_bind_4 64..116 CDD:459790 15/51 (29%)
Cpr65EcNP_648077.1 Chitin_bind_4 41..88 CDD:459790 15/51 (29%)

Return to query results.
Submit another query.