DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr5C and Cpr65Az

DIOPT Version :10

Sequence 1:NP_572266.1 Gene:Cpr5C / 31510 FlyBaseID:FBgn0029811 Length:145 Species:Drosophila melanogaster
Sequence 2:NP_648031.1 Gene:Cpr65Az / 38712 FlyBaseID:FBgn0035686 Length:239 Species:Drosophila melanogaster


Alignment Length:187 Identity:39/187 - (20%)
Similarity:54/187 - (28%) Gaps:77/187 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 KFVALLALIAAASAGV--LPAGQLYHAA-PVATY------------AAPAPA----AVLKTVAQP 49
            :...|.:||..|...|  .|||  |.:| |.|||            ..||||    ...|...:|
  Fly     2 RLTTLFSLICIAIGYVRSQPAG--YPSARPPATYLPVKPPAPPPRPPPPAPANSYGPPKKGNGKP 64

  Fly    50 VLAKADEEYDPHPQ--------------------------------------------------Y 64
            ..|.....|.|.|:                                                  |
  Fly    65 PPAPPKPSYGPPPKNGNGKPPPSNAYLPPGNGNGGSSGGGGAGGGGGEDIPIIKLESKVNTDGSY 129

  Fly    65 KYAYDVQDAISGD-----SKSQVEERDGDVVRGEYSLVDSDGFKRTVQYTADPINGF 116
            .|.|:..:.|..:     ..:.||..:.....|.:|....:|.:.::.|.||. |||
  Fly   130 MYEYETGNGIKAEEMGYLKNAGVEGAEAQTAEGSFSYTSPEGQEISLTYIADE-NGF 185

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr5CNP_572266.1 Chitin_bind_4 64..116 CDD:459790 13/56 (23%)
Cpr65AzNP_648031.1 Chitin_bind_4 129..185 CDD:459790 13/56 (23%)

Return to query results.
Submit another query.