DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr5C and Cpr64Aa

DIOPT Version :10

Sequence 1:NP_572266.1 Gene:Cpr5C / 31510 FlyBaseID:FBgn0029811 Length:145 Species:Drosophila melanogaster
Sequence 2:NP_647872.1 Gene:Cpr64Aa / 38508 FlyBaseID:FBgn0035510 Length:192 Species:Drosophila melanogaster


Alignment Length:144 Identity:76/144 - (52%)
Similarity:97/144 - (67%) Gaps:13/144 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAFKFVALL-ALIAAASAGVLPAGQLYHAAPVATYAAPAPAAVLKTVAQPVLAK--ADEEYDPHP 62
            ||.|.:.:| ||:|.:||.|:|...|  |.|    |.|:..|:.| ||.|::||  ..|.|||:|
  Fly     1 MAQKLILVLSALVAVSSAVVVPGPGL--ALP----AYPSYPALAK-VAAPLVAKVAGPEPYDPNP 58

  Fly    63 QYKYAYDVQDAISGDSKSQVEERDGDVVRGEYSLVDSDGFKRTVQYTADPINGFNAVVNREPLVK 127
            ||.::|||.|..:||.|||.|.|.||||:|.|||:::||.:|.|:|||||::||||||.||   .
  Fly    59 QYTFSYDVHDGSTGDVKSQQETRSGDVVQGAYSLIEADGTRRIVEYTADPVHGFNAVVRRE---G 120

  Fly   128 TVVKTVAPVAPVYA 141
            .|||.|||||.|.|
  Fly   121 AVVKAVAPVAKVLA 134

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr5CNP_572266.1 Chitin_bind_4 64..116 CDD:459790 29/51 (57%)
Cpr64AaNP_647872.1 Chitin_bind_4 60..112 CDD:459790 29/51 (57%)

Return to query results.
Submit another query.