DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr5C and Cpr56F

DIOPT Version :10

Sequence 1:NP_572266.1 Gene:Cpr5C / 31510 FlyBaseID:FBgn0029811 Length:145 Species:Drosophila melanogaster
Sequence 2:NP_611470.1 Gene:Cpr56F / 37299 FlyBaseID:FBgn0034499 Length:217 Species:Drosophila melanogaster


Alignment Length:190 Identity:51/190 - (26%)
Similarity:71/190 - (37%) Gaps:74/190 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 AFKFVALLALIA----------------------AASAGVLPAGQLYHA---------------- 28
            ||..:|||..:|                      |.|...||..|.|.:                
  Fly     3 AFTSIALLVCLAAWTHAEPPVPQNQYLPPNQSPQAPSNNYLPPTQGYQSPSSNYLPPQRAGGNGG 67

  Fly    29 APVATYAAP---------APA---AVLK------------------TVAQPVLAKADEEYDPHPQ 63
            ||..:|.||         |||   |:.|                  ...|    :.:|:|.| .:
  Fly    68 APSNSYGAPIAPPQGQYGAPALTGAIFKGGNGNGNGGYGGGNGNGNGYGQ----RDEEQYGP-AK 127

  Fly    64 YKYAYDVQDAISGDSKSQVEERDGDVVRGEYSLVDSDGFKRTVQYTADPINGFNAVVNRE 123
            |::.|||||..||:....:|.||||:..|.|.::..||.|:.|:|.||. ||:...:..|
  Fly   128 YEFKYDVQDYESGNDFGHMESRDGDLAVGRYYVLLPDGRKQIVEYEADQ-NGYRPTIRYE 186

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr5CNP_572266.1 Chitin_bind_4 64..116 CDD:459790 23/51 (45%)
Cpr56FNP_611470.1 Chitin_bind_4 128..179 CDD:459790 23/51 (45%)

Return to query results.
Submit another query.