DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr5C and Cpr49Ad

DIOPT Version :10

Sequence 1:NP_572266.1 Gene:Cpr5C / 31510 FlyBaseID:FBgn0029811 Length:145 Species:Drosophila melanogaster
Sequence 2:NP_610773.1 Gene:Cpr49Ad / 36349 FlyBaseID:FBgn0033726 Length:166 Species:Drosophila melanogaster


Alignment Length:95 Identity:27/95 - (28%)
Similarity:41/95 - (43%) Gaps:21/95 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 YAAPAPAAVLKTVAQPVLAKADEEYDPHPQYKYAYDVQDAISGDSK--------SQVEERDGDVV 90
            |.|.|.|.:::       ...|..|.. ..|.|.|:.::.|.|:.:        .|.||:    |
  Fly    61 YIAAAQARIVE-------QNNDVNYGA-GSYSYNYETENGIHGEERGVPVNIGNQQQEEQ----V 113

  Fly    91 RGEYSLVDSDGFKRTVQYTADPINGFNAVV 120
            .|.||.:..:|.:..|:|.|| .|||..|:
  Fly   114 EGAYSFITPEGLRVGVKYLAD-ANGFRPVI 142

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr5CNP_572266.1 Chitin_bind_4 64..116 CDD:459790 18/59 (31%)
Cpr49AdNP_610773.1 Chitin_bind_4 83..138 CDD:459790 18/59 (31%)

Return to query results.
Submit another query.