DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr5C and Crys

DIOPT Version :10

Sequence 1:NP_572266.1 Gene:Cpr5C / 31510 FlyBaseID:FBgn0029811 Length:145 Species:Drosophila melanogaster
Sequence 2:NP_476906.1 Gene:Crys / 34604 FlyBaseID:FBgn0005664 Length:477 Species:Drosophila melanogaster


Alignment Length:79 Identity:40/79 - (50%)
Similarity:63/79 - (79%) Gaps:0/79 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 AQPVLAKADEEYDPHPQYKYAYDVQDAISGDSKSQVEERDGDVVRGEYSLVDSDGFKRTVQYTAD 111
            |..:...::|:||..|||.:||||:|:::||.|.|.|:||||:|:|:|||::.||.:|.|:||||
  Fly    60 ATTLAPNSNEDYDTRPQYSFAYDVRDSLTGDDKRQEEKRDGDLVKGQYSLIEPDGTRRIVEYTAD 124

  Fly   112 PINGFNAVVNREPL 125
            .::||||:|:::.|
  Fly   125 DVSGFNAIVSKQRL 138

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr5CNP_572266.1 Chitin_bind_4 64..116 CDD:459790 28/51 (55%)
CrysNP_476906.1 Chitin_bind_4 77..129 CDD:459790 28/51 (55%)

Return to query results.
Submit another query.