DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr5C and LOC3290077

DIOPT Version :10

Sequence 1:NP_572266.1 Gene:Cpr5C / 31510 FlyBaseID:FBgn0029811 Length:145 Species:Drosophila melanogaster
Sequence 2:XP_556644.2 Gene:LOC3290077 / 3290077 VectorBaseID:AGAMI1_006388 Length:168 Species:Anopheles gambiae


Alignment Length:65 Identity:36/65 - (55%)
Similarity:47/65 - (72%) Gaps:0/65 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 EEYDPHPQYKYAYDVQDAISGDSKSQVEERDGDVVRGEYSLVDSDGFKRTVQYTADPINGFNAVV 120
            ::|..:|:||:.|.|:|..:||.|||.|.||||||:|||:|.:.||..|.|:|.||..|||.|||
Mosquito    61 KDYYAYPKYKFEYGVKDYHTGDHKSQWEVRDGDVVKGEYTLDEPDGSTRIVKYHADSKNGFEAVV 125

  Fly   121  120
            Mosquito   126  125

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr5CNP_572266.1 Chitin_bind_4 64..116 CDD:459790 29/51 (57%)
LOC3290077XP_556644.2 None

Return to query results.
Submit another query.