DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr5C and Cpr65Av

DIOPT Version :10

Sequence 1:NP_572266.1 Gene:Cpr5C / 31510 FlyBaseID:FBgn0029811 Length:145 Species:Drosophila melanogaster
Sequence 2:NP_729146.1 Gene:Cpr65Av / 318014 FlyBaseID:FBgn0052405 Length:111 Species:Drosophila melanogaster


Alignment Length:114 Identity:29/114 - (25%)
Similarity:42/114 - (36%) Gaps:31/114 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 ALLALIAAASAGVLPAGQLYHAAPVATYAAPAPAAVLKTVAQPVLAKADEEYDPHPQYKYAYDVQ 71
            |||:.|.||     |.....||                     .:.:.|.:......|.:.|:..
  Fly    15 ALLSTIRAA-----PLDDSQHA---------------------TILRYDNDNIGTDGYNFGYETS 53

  Fly    72 DAISGDSKSQVEERDGD----VVRGEYSLVDSDGFKRTVQYTADPINGF 116
            |.::...:::|:....|    .|||..|.|..||...|:.|.||. |||
  Fly    54 DGVTRQEQAEVKNAGTDQEALSVRGSVSWVAPDGQTYTLHYIADE-NGF 101

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr5CNP_572266.1 Chitin_bind_4 64..116 CDD:459790 17/55 (31%)
Cpr65AvNP_729146.1 Chitin_bind_4 46..101 CDD:459790 17/55 (31%)

Return to query results.
Submit another query.