DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr5C and Cpr49Aa

DIOPT Version :10

Sequence 1:NP_572266.1 Gene:Cpr5C / 31510 FlyBaseID:FBgn0029811 Length:145 Species:Drosophila melanogaster
Sequence 2:NP_001097285.1 Gene:Cpr49Aa / 246413 FlyBaseID:FBgn0050045 Length:144 Species:Drosophila melanogaster


Alignment Length:119 Identity:27/119 - (22%)
Similarity:52/119 - (43%) Gaps:13/119 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 LYHAAPVATYAAPAPAAVLKTVAQPV-LAKADEEYDPHPQYKYAYDVQDAISGDSKSQVE----E 84
            |:.||.:.:.|...|....:...:|: :.:.::|.:....|||.|:..:.|:.:.:..::    :
  Fly     6 LFIAALLLSLAQARPQVRGQAPGEPIPIIRQEQEVNFDGSYKYLYETGNGINAEEEGYLKNPGTD 70

  Fly    85 RDGDVVRGEYSLVDSDGFKRTVQYTADPINGFNAVVNREPLVKTVVKTVAPVAP 138
            ..|.|.:|.:|....:|....:.|.||. |||....:..|       |..|:.|
  Fly    71 NAGQVAQGSFSYTSPEGIPIRITYLADE-NGFQPQGDHLP-------TPPPIPP 116

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr5CNP_572266.1 Chitin_bind_4 64..116 CDD:459790 14/55 (25%)
Cpr49AaNP_001097285.1 Chitin_bind_4 46..101 CDD:459790 14/55 (25%)

Return to query results.
Submit another query.