DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr5C and LOC1270229

DIOPT Version :10

Sequence 1:NP_572266.1 Gene:Cpr5C / 31510 FlyBaseID:FBgn0029811 Length:145 Species:Drosophila melanogaster
Sequence 2:XP_308908.3 Gene:LOC1270229 / 1270229 VectorBaseID:AGAMI1_001941 Length:244 Species:Anopheles gambiae


Alignment Length:196 Identity:56/196 - (28%)
Similarity:76/196 - (38%) Gaps:77/196 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 KFVALLALIAAA---SAGVLPAGQLY------------------HAAPVATYAAPAPAAVLKT-- 45
            :||:.:|::||.   ||.|.||...:                  |.||....|...|..:|:.  
Mosquito     3 RFVSAIAILAATAVQSAPVEPAQYAFVTKHHHVPEQHHHVLEHVHHAPEPQLAVHYPVELLQDHH 67

  Fly    46 -VAQPVL-----------------------------------------------------AKADE 56
             ..|.||                                                     ||..:
Mosquito    68 HEPQLVLSNDKYIGEAHEYHHHEAPATSYSEGNDYSSLYGGKHGSHLYDNYQYGQYESGYAKKYD 132

  Fly    57 EYDPHPQYKYAYDVQDAISGDSKSQVEERDGDVVRGEYSLVDSDGFKRTVQYTADPINGFNAVVN 121
            ||:.:|:|.:.|.|.|..:||.|.|.|.||||||:|.|.|.::||..|.|:||:|..|||||||.
Mosquito   133 EYNAYPKYSFEYGVDDPHTGDHKKQWEFRDGDVVKGGYMLKEADGTTRVVEYTSDDHNGFNAVVK 197

  Fly   122 R 122
            :
Mosquito   198 K 198

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr5CNP_572266.1 Chitin_bind_4 64..116 CDD:459790 26/51 (51%)
LOC1270229XP_308908.3 Chitin_bind_4 140..192 CDD:459790 26/51 (51%)

Return to query results.
Submit another query.