DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15767 and CG2852

DIOPT Version :10

Sequence 1:NP_572264.1 Gene:CG15767 / 31508 FlyBaseID:FBgn0029809 Length:370 Species:Drosophila melanogaster
Sequence 2:NP_611695.1 Gene:CG2852 / 37591 FlyBaseID:FBgn0034753 Length:205 Species:Drosophila melanogaster


Alignment Length:146 Identity:31/146 - (21%)
Similarity:55/146 - (37%) Gaps:19/146 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   215 GRPLGQVVVQLYTEAAPLVVLQFVRTCL-----GQRSHEFAVRRIFPRLWVEGYLLSSCKNSLGE 274
            |.|.|::.:.|:.:..|..|..|....|     |.:..:|  .||.....::|   .......|.
  Fly    39 GEPAGRIEIGLFGKTVPKTVENFKELALKPQGEGYKGSKF--HRIIKDFMIQG---GDFTKGDGT 98

  Fly   275 ASSLSYRDPMEFDTRVVSH--ARYAFVLSCAKEYCVHGFPGGAINFSISFKPLPVARGQRVGFGR 337
            .....|.:..|.:...:.|  |.:..:.:..|:      ..|: .|.|:.|......|:.|.||:
  Fly    99 GGRSIYGERFEDENFKLKHYGAGWLSMANAGKD------TNGS-QFFITTKQTSWLDGRHVVFGK 156

  Fly   338 VIRGDKVIEAMEAHGT 353
            ::.|..|:..:|...|
  Fly   157 ILSGMNVVRQIENSAT 172

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15767NP_572264.1 Pro_isomerase 218..368 CDD:459694 29/143 (20%)
CG2852NP_611695.1 cyclophilin 30..188 CDD:469651 31/146 (21%)

Return to query results.
Submit another query.