DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42699 and Cep162

DIOPT Version :8

Sequence 1:NP_572263.2 Gene:CG42699 / 31507 FlyBaseID:FBgn0261610 Length:897 Species:Drosophila melanogaster
Sequence 2:NP_001263989.1 Gene:Cep162 / 300880 RGDID:1307365 Length:1403 Species:Rattus norvegicus

Alignment Length:1089 Identity:208/1090 (19%)
Similarity:382/1090 (35%) Gaps:376/1090 (34%)


  Fly     7 PHKQ------------GV-SEADALDYTNSSSIIEFLAKEQDCGGILNDPDPESIFQEVSRLSDS 58
            ||:|            || |...|.:.......:|.|.|:......|...|.::.....||||  
  Rat   406 PHEQDESVVLHRTAGEGVGSSCPATEEHLDKMYLEILRKKTSVNPSLLPQDNKANQTSRSRLS-- 468

  Fly    59 TDMRSVDELLQEAERLIQQQLRLGGIVP-KLDASGPPAPTKT----LGEEAATGGDGSSSSP--- 115
                     .:|...:..:|      || |...|.||.|.:.    |...|.:.|....|||   
  Rat   469 ---------AREEAPVTSKQ------VPCKKARSAPPLPRRKPQSGLYASARSSGYSKPSSPLQF 518

  Fly   116 ------QSSPHSSIRLNTRYTHRIEHSPAPLA---PKTVAVNGR--VRPRSGSKSS----ASPTS 165
                  ::|..::...|.|        |.|.:   .|...::|.  ::|.:.:|.|    .||.:
  Rat   519 FSALEKKTSKDNTKTKNVR--------PIPTSNQFRKREILSGTKLIKPAALNKPSPHREGSPAT 575

  Fly   166 VQTPLESSNGCGFAAFVDNLPS------------------------ASVISEE----STPKDMDM 202
            .:.|.:.|:........:.|.|                        |..:.|:    .:.|:.::
  Rat   576 PKRPEDPSDDSFVQLQTETLGSYGGNREKELLMLKRAQDAEEKWRGAQALIEQIKMTFSEKEKEL 640

  Fly   203 ENHTAAMAKLQLQQL----QDN------------------------TDDD------EDTMEEITE 233
            ||...::.:.|.::|    |:|                        |.|.      :...:||.|
  Rat   641 ENTVESLKRQQERELFKLNQENYILQAKLSSFEETSRKQRWLQFGETSDPLTEEKLKQIQKEIQE 705

  Fly   234 AEV--------DAPIFSRAEDTGKEVRSPPERQFKSQGRSYIQPSQPIRPMASYSE--------- 281
            .|.        :..::|:.:|..::.:...||.||.....:.:       :||..|         
  Rat   706 QETLLQGYQQENERLYSQVKDLQEQNKKNEERMFKENQNLFSE-------LASLKEQMHKNHFLP 763

  Fly   282 KAVGSSPKRMVSTLTSPIEQI-ASSVSREH-------------ALKLEIEQL---QERLKD---- 325
            :||.:.......:.|..:.:: |:...:.|             ||::::|::   :::.||    
  Rat   764 QAVENIEPTKNQSFTDLLAELRAAQKEKNHLMEDIKRLKQDKQALEVDLERVKRERDQAKDQIAY 828

  Fly   326 -TEERLASVRLQSDSLSQTQRALREHNSRLQEESEMLKLDVQHL---NECANVLRSELQAARRDR 386
             |.|:|..:::..::..|....|::......|..|:|..|...|   ||....|:.|::..:.:.
  Rat   829 TTGEKLYEIKILEETHKQEVSRLQKRLQWYAENQELLDKDAARLREANEETERLKLEIEKLKTES 893

  Fly   387 GEALQMQRSLRDELEEANQERRRTGEGKEKDSRVIQDLQRQCREMERILMRKHPDSVSALIVASK 451
            |             ..|||:|.|:.| :..|::.||||:||.:|||.||.|::|:|:.|||:|:.
  Rat   894 G-------------SPANQQRLRSKE-RALDAKRIQDLERQVKEMEGILKRRYPNSLPALILAAS 944

  Fly   452 SSGMCPLNDQENVNSRKLLEQRIAQLESDAKEQDRKAQQILANVQARFNSVQAKYETHIADLETQ 516
            ::|     |..:.|:...:|:||.:||:|.:.:|.:|::.|..::.:|..::.:||         
  Rat   945 AAG-----DSVDRNTVDFMERRIKKLEADLEGKDEEAKKSLRTMEQQFQKMKIQYE--------- 995

  Fly   517 VLSLQEINTKLNEQIESQVRTLDRYMQKRADRYYNNCTQTEPLEEDDVSVGGGVNHGRATPVSSN 581
                        :::|.|.:.|....::.....:|:.::.:.||.:    .||:...        
  Rat   996 ------------QRLEEQEQMLAHRQREAPQNQHNSSSRLKALETE----LGGIKEA-------- 1036

  Fly   582 TMGTQTQAANGTRDHSTNTIGCPSPALVCQQQHLHQAHGHLHPHAPSASSSTSSTANSTPNTSRP 646
                          |........:...|.:.|:.|..|                         :.
  Rat  1037 --------------HQITVRKLEAEIDVLKHQNAHLEH-------------------------KK 1062

  Fly   647 NSKQSGGQRRSPLVTAGPSKLPISQSDSTLSLLSHGGGGSKEEAQLLSSVRSMRVDLAIKNKAMQ 711
            |.|:                      |..|..:..    ..|:||..:.:..:..:||.|.:.:|
  Rat  1063 NDKE----------------------DQDLQSIEF----QVEQAQARAKLARLNEELAAKGREIQ 1101

  Fly   712 RLTRELDECKKTIRKLQRDKEGSGSGSQTGSKL--DLRSQASGGAMQQRRSSG---YDHHHHSD- 770
            .||:.::..:|..|.:...:...|.......:|  ::....||.|.....:.|   |..|..:| 
  Rat  1102 DLTKTVERLQKERRMMLSRQSPRGREEMAAKRLKKEILHPNSGNANAFSETLGAKLYHPHTFTDS 1166

  Fly   771 HIPAATESQALKEAQNKYRL------------------------LEADYKTLHDKRLQDLKTLQS 811
            ||     |:.|:|   .|||                        ||:..|.:.|.....:.:|::
  Rat  1167 HI-----SEVLEE---NYRLRSELEGLTLEREKLKMESEAAVCQLESSMKRVKDDAAAHIASLKA 1223

  Fly   812 AHERELAS--CNETV---------------------------------------------RILQQ 829
            |||||:..  |...|                                             .|||:
  Rat  1224 AHEREIEKLLCQNAVENSSSRVAELNRKIATQEVLLKHFQGQVNELQGKQESLSLSQVREEILQK 1288

  Fly   830 RLNEREEALTTQKRRKVP--VDYYALKAKVSLLERRHSEREERLHMLVE 876
            ::.:..|.|...|....|  ..:..|:.|:..:|.||.:||:.|..:::
  Rat  1289 QITKLLEELKEAKENHTPEMKHFMGLERKIKQMEMRHKQREQELQQIIQ 1337

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG42699NP_572263.2 FlaC <316..423 CDD:225888 27/118 (23%)
Cep162NP_001263989.1 Smc <613..1300 CDD:224117 151/819 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_28K8R
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0006309
OrthoInspector 1 1.000 T1089153
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 LDO PTHR34031
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.000

Return to query results.
Submit another query.