DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42699 and LOC100497718

DIOPT Version :8

Sequence 1:NP_572263.2 Gene:CG42699 / 31507 FlyBaseID:FBgn0261610 Length:897 Species:Drosophila melanogaster
Sequence 2:XP_017945742.1 Gene:LOC100497718 / 100497718 -ID:- Length:806 Species:Xenopus tropicalis

Alignment Length:850 Identity:166/850 (20%)
Similarity:327/850 (38%) Gaps:271/850 (32%)


  Fly   183 DNLPSASVISEES-TPKDMDMENHTAAMAKLQLQQLQDNTDDDED----TMEEITEAEVDAPIFS 242
            |:..|||....:| .|:.::|.:....|. |:||.::...:.|:.    ..||..:.|.:  ...
 Frog    83 DSFRSASGFHVDSNAPQSLNMSDAELNMF-LKLQNIEQKLNSDQTHSNILREEFLKKEEE--FLE 144

  Fly   243 RAED--TGKEVRSPPERQFKSQGRSYIQPSQPIRPMASYSEKAVG----SSPKRMVSTLTSPIEQ 301
            :.||  |..||    :.|.:.| .:||..:: :..|...:.|::.    ..||..|:  ...|:|
 Frog   145 KIEDLKTKYEV----DLQHRKQ-ENYILLTK-LHAMEDKNIKSINKVNLGDPKDPVT--DEKIQQ 201

  Fly   302 IASSVSRE----HALKLEIEQLQERLKDTE-------------------------ERLASV---- 333
            |...:.::    |..:.|.|:|.:::|:.:                         |:|:.|    
 Frog   202 IRKEIEKQEKLLHGYQQENERLYQQVKELQIRNKQNEELMFQENQSLKANLLSLREQLSKVTISH 266

  Fly   334 -RLQSDS--------------LSQTQRALREHN-----SRLQEESEMLKLDVQHL---------- 368
             |.|.:|              |...|:  ||.|     ||.:::.:.|::|:..:          
 Frog   267 QRPQDNSEKCNSQSFTDLLVELRTVQK--REANLLDEISRQKQDKQALEVDLMQMRKERDNAPDV 329

  Fly   369 -----------------NECANVLRSELQ------------AAR-RDRGEALQMQRSLRDEL--E 401
                             .:..|||..:|:            |.| ||..|.:::.:...::|  |
 Frog   330 YVSGDKSYEMKMMEETYKQEINVLNKKLKWFAESQELLDKDAYRLRDAYEQIEILKMQVEKLKNE 394

  Fly   402 EANQERRRTGEGKEK--DSRVIQDLQRQCREMERILMRKHPDSVSALIVASKSSGMCPLNDQENV 464
            ..||..::....||:  |::.||||:||.:|||.|:.|:||:|:.||..|:.::..|...|....
 Frog   395 TGNQSVQQQKRAKERAADAKHIQDLERQVKEMEGIIKRRHPNSILALTFAAAAAPECDDKDSAKK 459

  Fly   465 NSRKLLEQRIAQLESDAKEQDRKAQQILANVQARFNSVQAKYETHIADLETQVLSLQEINTKLNE 529
            |:...||:|:.:||:|.:.:|.::::.|..::.:|..|:.:||:.|.:|| ::|:.:.||.    
 Frog   460 NTIAFLERRVKKLETDLESKDDESKKSLRTMEQQFQKVKIQYESRIKELE-ELLTHKLINP---- 519

  Fly   530 QIESQVRTLDRYMQKRADRYYNNCTQTEPLEEDDVSVGGGVNHGRATPVSSNTMGTQTQAANGTR 594
                            ..:.::|.|:.:..|::                                
 Frog   520 ----------------PQKPFDNSTKAQKFEDE-------------------------------- 536

  Fly   595 DHSTNTIGCPSPALVCQQQHLHQAHGHLHPHAPSASSSTSSTANSTPNTSRPNSKQSGGQRRSPL 659
                        .|:|::.|                          ..|.:...:|....|:..|
 Frog   537 ------------LLICKETH--------------------------QTTIQNLQRQIDLHRKKNL 563

  Fly   660 VTAGPSKLPISQSDSTLSLLSHGGGGSKEEAQLLSSVRSMRVDLAIKNKAMQRLTRELDECKKTI 724
            |.....:    :.::.||.:    |...||......:..:..:|..|...:|.||       ||:
 Frog   564 VLENNER----KKEANLSDI----GTKVEEHSNKDLIAKLSQELIAKRIEIQDLT-------KTV 613

  Fly   725 RKLQR--------------DKEGSGSGSQTGS--KLDLRSQAS-GGAMQQRRSSGYDHHHHSDHI 772
            .:||:              ||:.|.:.:...:  |..:|...: .|.:.:::       :|    
 Frog   614 ERLQKERMIMLSNPLIKAADKKSSQARTDISALGKRSIRDNMNFPGTLDEKQ-------YH---- 667

  Fly   773 PAATESQALKEAQNKYRLLEADYKTLHDKRLQDLKTLQSAHERELASCNETVRILQQRLNEREEA 837
            |.......:.:||.:...|:.:.:.|..|..:..:|.|:.    |:....|::.|::..:|:..|
 Frog   668 PGTFADIHISDAQAENTALKCEVERLSLKINEQKETFQTL----LSQAENTIKRLKEEGSEQASA 728

  Fly   838 LTTQKRRKV-------PVDYYALKAKVSLLERRHSERE---ERLHMLVEALSKGRLNGALEDLMQ 892
            |....:::|       .:|:.:  :||:.|..:.|.:|   :.|...|:.|.|.|.:.::..:.:
 Frog   729 LKLLHQKEVEKLICQHAIDHSS--SKVAELSSKTSTQEILIKHLQTQVKELQKDRESLSVYRIRE 791

  Fly   893 ENNNK 897
            |...|
 Frog   792 ETLQK 796

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG42699NP_572263.2 FlaC <316..423 CDD:225888 36/200 (18%)
LOC100497718XP_017945742.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0006309
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.