DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG3108 and CPA4

Sequence 1:NP_572262.1 Gene:CG3108 FlyBaseID:FBgn0029807 Length:1132 Species:Drosophila melanogaster
Sequence 2:NP_057436.2 Gene:CPA4 HGNCID:15740 Length:421 Species:Homo sapiens

Alignment Length:383 Identity:144/384 (38%)
Similarity:216/384 (56%) Gaps:14/384 (4%)


  Fly   722 RYDGAQVWRIVVQTDKDKRMADELQSKYDGQL--WK---EVKQEVDYLLKPQVLAAAERHIRAAN 781
            ::.|.||.||.|:...:.....:|.:..:.:|  ||   ...:.||.|:....|.|.:..:|:..
Human    20 KFFGDQVLRINVRNGDEISKLSQLVNSNNLKLNFWKSPSSFNRPVDVLVPSVSLQAFKSFLRSQG 84

  Fly   782 LSRIVLIDNLQRVIEKENPPAEKIAELQNRKGHRLTWQAYHRLEDIHGFIDYMAKTYPDICSTEI 846
            |...|.|::||.:::.|:...:. .|.|.|..:...:.|||.||.|:..:|.:|..:||:.....
Human    85 LEYAVTIEDLQALLDNEDDEMQH-NEGQERSSNNFNYGAYHSLEAIYHEMDNIAADFPDLARRVK 148

  Fly   847 IGYSVEKRPLKILKISNG-NARNPGIWIDGGMHAREWISPATVTYIANQLVEGWEDLP---EHMR 907
            ||:|.|.||:.:||.|.| ..|.|.:|::.|:|:|||||.||..:.|.::|..::..|   ..:.
Human   149 IGHSFENRPMYVLKFSTGKGVRRPAVWLNAGIHSREWISQATAIWTARKIVSDYQRDPAITSILE 213

  Fly   908 SINWYIHPVANPDGYEYSHTTDRLWRK-NMRAHGRQCPGVDLNRNFGYKWGGKGTSASPCSQTYR 971
            .::.::.||||||||.|:.|.:||||| ..|..|..|.|.|.|||:...:.|||.|.:|||:.|.
Human   214 KMDIFLLPVANPDGYVYTQTQNRLWRKTRSRNPGSSCIGADPNRNWNASFAGKGASDNPCSEVYH 278

  Fly   972 GSKAFSEPETFYISKFISGFPRETFQAYLSFHSYGQYILYPWGYDYQLTQDRADLDRVARQAGTS 1036
            |..|.||.|...:..||.  ....|:.::..|||.|.::||:||..:...|..:||:|||.|..:
Human   279 GPHANSEVEVKSVVDFIQ--KHGNFKGFIDLHSYSQLLMYPYGYSVKKAPDAEELDKVARLAAKA 341

  Fly  1037 ITKSTGVKYTVGSSATTLYPAAGGSDDWAKGIAGIKYAYTIEMGDTGRYGFVLPARFI 1094
            :...:|.:|.||.:.||:|||:|.|.|||.. .|||:|:|.|:.|||.|||:|||..|
Human   342 LASVSGTEYQVGPTCTTVYPASGSSIDWAYD-NGIKFAFTFELRDTGTYGFLLPANQI 398

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG3108NP_572262.1 Propep_M14 730..797 CDD:280416 18/72 (25%)
M14_CP_A-B_like 821..1112 CDD:199844 118/280 (42%)
CPA4NP_057436.2 Propep_M14 27..101 CDD:308061 18/74 (24%)
M14_CPA 118..419 CDD:133081 119/285 (42%)
Substrate binding 181..184 2/3 (67%)
Substrate binding. {ECO:0000250|UniProtKB:P00730} 256..257 1/1 (100%)
Substrate binding 275..276 0/1 (0%)
Substrate binding. {ECO:0000250|UniProtKB:P00730} 309..310 1/1 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C69631634
eggNOG 1 0.900 E1_COG2866
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 H56753
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D208397at33208
OrthoFinder 1 1.000 FOG0000073
OrthoInspector 1 1.000 T130287
orthoMCL 1 0.900 OOG5_128876
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.632 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1730
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
98.680

Return to query results.
Submit another query.