DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG3108 and CG4408

Sequence 1:NP_572262.1 Gene:CG3108 FlyBaseID:FBgn0029807 Length:1132 Species:Drosophila melanogaster
Sequence 2:NP_651141.2 Gene:CG4408 FlyBaseID:FBgn0039073 Length:479 Species:Drosophila melanogaster

Alignment Length:411 Identity:132/412 (32%)
Similarity:215/412 (52%) Gaps:30/412 (7%)


  Fly   722 RYDGAQVWRIVVQTDKDKRMADELQSKYDGQLW----KEVKQEVDYLLKPQVLAAAERHIRAANL 782
            |||..:::::.:.:::..|:...|:...|...:    ::..|::..::....:|..:..:.:.|:
  Fly    80 RYDHTRIYQVELASEEHVRLFQALEQASDSCSFMGHARQPGQKLTIMVTGAKVADFDDLVHSYNV 144

  Fly   783 SRIVLIDNLQRVIEK---ENPPAEKIAELQNRKGHRLTWQAYHRLEDIHGFIDYMAKTYPDICST 844
            :..||..|.|.:|:.   |..|       ::.|.....|:.||.||.|:.::..:|:|:|::...
  Fly   145 THRVLNYNFQALIDANYLEVAP-------EDTKPEEFDWKRYHPLESINAWLKKLAETHPEVLLV 202

  Fly   845 EIIGYSVEKRPLKILKISNGNARNPGIWIDGGMHAREWISPATVTYIANQLVEGWEDLPEHM-RS 908
            | :|.|.:.||:..::|:..|.....::::.|:||||||:|||.|||.:|||...:...:.: ||
  Fly   203 E-LGVSAQGRPILGVQIAFDNENRTTVFVESGIHAREWIAPATATYIIDQLVNSKDSAVQALARS 266

  Fly   909 INWYIHPVANPDGYEYSHTTDRLWRKNMRAHGRQCPGVDLNRNFGYKWGGKGTSASPCSQTYRGS 973
            ..|||.|..|||||:|:...||:||||....| .|.||||||||.:.|...|.|..||...|.|.
  Fly   267 QRWYIFPTVNPDGYQYTFKGDRMWRKNRALFG-ICRGVDLNRNFPFHWNVTGASGDPCRYDYSGP 330

  Fly   974 KAFSEPETFYISKFI-SGFPRETFQAYLSFHSYGQYILYPWGYDYQLTQDRADLDRVARQAGTSI 1037
            .|.||.||..:.:|| .....|..:.::|.|||.|.|::|:|:..:...:..||..:.:.|...|
  Fly   331 SAASEVETQRMIEFIRHRVESERIRTFISLHSYSQMIMFPYGHSAERVDNYHDLTDIGKLAANKI 395

  Fly  1038 TKSTGVKYTVGSSATTLYPAAGGSDDWAKGIAGIKYAYTIEM---GDTGRYGFVLPARFIQYNGK 1099
            ...:|..|..||...|:||::|||.|||.|...|...::.|:   .|:... |:|.|:.|:    
  Fly   396 KDVSGRIYKSGSIYETIYPSSGGSKDWAHGQLKIPITFSYELRGPADSEDL-FILSAKEIE---- 455

  Fly  1100 DGVTFADTVA--RAIAQGRGK 1118
              .|.|:..|  :.|.|..||
  Fly   456 --PTAAEAFASIQTIVQEAGK 474

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG3108NP_572262.1 Propep_M14 730..797 CDD:280416 11/71 (15%)
M14_CP_A-B_like 821..1112 CDD:199844 110/298 (37%)
CG4408NP_651141.2 Propep_M14 88..159 CDD:280416 11/71 (15%)
M14_CP_A-B_like 179..472 CDD:199844 112/302 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C71102134
eggNOG 1 0.900 E1_COG2866
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D208397at33208
OrthoFinder 1 1.000 FOG0000073
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR11705
RoundUp 00.000 Not matched by this tool.
54.940

Return to query results.
Submit another query.