DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG3108 and CG8563

Sequence 1:NP_572262.1 Gene:CG3108 FlyBaseID:FBgn0029807 Length:1132 Species:Drosophila melanogaster
Sequence 2:NP_001261515.1 Gene:CG8563 FlyBaseID:FBgn0035777 Length:440 Species:Drosophila melanogaster

Alignment Length:432 Identity:137/433 (32%)
Similarity:206/433 (48%) Gaps:62/433 (14%)


  Fly   683 LQVQDSVLNY----VNASFMQQQPSETDLPKTEEESPFNAHLRRYDGAQVWRIVVQTDKDKRMAD 743
            ||..|:.|::    .|:|.:...|..    ||:.|:..::....|:...:..::.....:...||
  Fly    50 LQTNDAELDFWLLTRNSSVLTVSPRR----KTQFEASLSSLGVSYEMQPLMELMAALQANSSFAD 110

  Fly   744 ELQSKYDGQLWKEVKQEVDYLLKPQVLAAAERHIRAANLSRIVLIDNLQRVIEKENPPAEKIAEL 808
            :   .|||: ::|.:|:        ....|||..|                              
  Fly   111 D---NYDGE-YEECQQD--------ECEQAERPRR------------------------------ 133

  Fly   809 QNRKGHRLTWQAYHRLEDIHGFIDYMAKTYPDICSTEIIGYSVEKRPLKILKIS-NGNARNPGI- 871
            :.|:..|..:..|.|..::..|:..:|..||..|..|.:|.|.|.|.:..|.|| |...|...: 
  Fly   134 RTRRQARGFFSHYPRYHEVLSFMSGLAARYPQFCRYESLGRSNEGRHIAALSISLNSRVRPRRVA 198

  Fly   872 WIDGGMHAREWISPATVTYIANQLVEGWEDLPEHMRSINWYIHPVANPDGYEYSHTTDRLWRKNM 936
            :|....|.||||:..||.|:|.:|:.........::.:..::.|:.|||||||:|||||.||||.
  Fly   199 YIQAATHGREWITTQTVLYLAYELLSNLRAFTRVLQDVEIFLVPLVNPDGYEYTHTTDRFWRKNR 263

  Fly   937 -RAHGRQCPGVDLNRNFGYKWGGKGTSASPCSQTYRGSKAFSEPETFYISKFISGFPRETFQAYL 1000
             |..|..|.|||:|||||..|..:|.|.:.||:.|.|:...|||||..:.:::. |.|...:..|
  Fly   264 HRYAGHSCSGVDINRNFGNHWNYQGASQNLCSEVYSGTAPNSEPETSAVVRYLE-FNRNRVKLSL 327

  Fly  1001 SFHSYGQYILYPWGYDYQLTQDR-ADLDRVARQAGTSITKSTGVKYTVGSSATTLYPAAGGSDDW 1064
            ..||:|::|.||:||........ ..|..||.:|...|.:..|.:||.|:||:.||.|:|..||:
  Fly   328 DVHSFGKFIFYPYGYAKNTVPPTVGTLRSVALRAANQIGRYRGTRYTTGTSASILYEASGSLDDF 392

  Fly  1065 AKGIAGIKYAYTIEM-GDTGRYGFVLPARFIQYNGKDGVTFA 1105
            |.|..||..:||:|: ||.    |.:||..|.:..|:  |||
  Fly   393 AYGNLGIPLSYTLELPGDE----FHVPAHDIIHVCKE--TFA 428

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG3108NP_572262.1 Propep_M14 730..797 CDD:280416 11/67 (16%)
M14_CP_A-B_like 821..1112 CDD:199844 113/291 (39%)
CG8563NP_001261515.1 M14_CP_A-B_like 146..437 CDD:199844 113/291 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C5063727
eggNOG 1 0.900 E1_COG2866
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D208397at33208
OrthoFinder 1 1.000 FOG0000073
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR11705
RoundUp 00.000 Not matched by this tool.
54.940

Return to query results.
Submit another query.