DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG3108 and CG12374

Sequence 1:NP_572262.1 Gene:CG3108 FlyBaseID:FBgn0029807 Length:1132 Species:Drosophila melanogaster
Sequence 2:NP_610819.1 Gene:CG12374 FlyBaseID:FBgn0033774 Length:422 Species:Drosophila melanogaster

Alignment Length:387 Identity:118/388 (30%)
Similarity:212/388 (55%) Gaps:29/388 (7%)


  Fly   722 RYDGAQVWRIVVQT----DKDKRMADELQSKYDGQLWKEVKQEVDYLLKPQVLAAAERHIRAANL 782
            |||..:::::.::|    ::.|::.:.:...:..:| ..|..:.:.::.|....|.|:.::...:
  Fly    26 RYDHFRIYQLTIETNLQMEELKKIHEHISVHFLNEL-GAVGNKYNVIVGPLFHRALEKTLKFLEI 89

  Fly   783 SRIVLIDNLQRVIEKENPPAEKIAELQNRKGHRLTWQAYHRLEDIHGFIDYMAKTYPDICSTEII 847
            ...|::|:||::|::.:...:.          ::.|:.||.|:.|:.:||.....: |....::|
  Fly    90 VYEVIVDDLQKLIDESSVGDDS----------QMEWETYHTLDTIYDWIDQECAAH-DFLECKVI 143

  Fly   848 GYSVEKRPLKILKISNGNARNPGIWIDGGMHAREWISPATVTYIANQLVEGWEDLPEHMR---SI 909
            |.|.|.|.:|.:::|. .:.|..|:::|.:||.||||.||||::.|||:.. || ||..|   ..
  Fly   144 GQSYEGRDIKSIRLSK-RSGNKAIFLEGNIHAMEWISSATVTFLLNQLINS-ED-PEMQRLSEEY 205

  Fly   910 NWYIHPVANPDGYEYSHTTDRLWRKNMRAHGRQ-----CPGVDLNRNFGYKWGGKGTSA-SPCSQ 968
            :|.:.|:.||||:.|:|..:||||||.|.:|.:     |.|:|:||||.|.|||.|.:. .||..
  Fly   206 DWIVVPMVNPDGFVYTHEVERLWRKNRRPNGYRNESGDCYGIDMNRNFDYHWGGAGWNIDEPCDH 270

  Fly   969 TYRGSKAFSEPETFYISKFISGFPRETFQAYLSFHSYGQYILYPWGY-DYQLTQDRADLDRVARQ 1032
            .:.|.:..:|.|...:..|:|.|.....::|:::|:||||:|.|:|: :.:...:...:.|:|..
  Fly   271 WFGGEEPNTEVEIISLQNFVSSFEDGYIRSYMAYHAYGQYVLLPYGHSNTEFPPNYEQMKRIAAA 335

  Fly  1033 AGTSITKSTGVKYTVGSSATTLYPAAGGSDDWAKGIAGIKYAYTIEMGDTGRYGFVLPARFI 1094
            ...:.....|..:|.|:|....|..:|.:.|||.|:..|.:..|:|:.|.|.:||.||:..|
  Fly   336 FSDAAADVYGSTFTYGASGLLNYVVSGAAKDWAYGVKKIPFTCTVELRDKGTFGFFLPSNQI 397

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG3108NP_572262.1 Propep_M14 730..797 CDD:280416 12/71 (17%)
M14_CP_A-B_like 821..1112 CDD:199844 102/285 (36%)
CG12374NP_610819.1 Propep_M14 34..104 CDD:280416 12/71 (17%)
M14_CP_A-B_like 118..415 CDD:199844 102/285 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C71060473
eggNOG 1 0.900 E1_COG2866
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D208397at33208
OrthoFinder 1 1.000 FOG0000073
orthoMCL 1 0.900 OOG5_128876
Panther 1 1.100 P PTHR11705
RoundUp 00.000 Not matched by this tool.
65.840

Return to query results.
Submit another query.