DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG3108 and CG7025

Sequence 1:NP_572262.1 Gene:CG3108 FlyBaseID:FBgn0029807 Length:1132 Species:Drosophila melanogaster
Sequence 2:NP_609133.2 Gene:CG7025 FlyBaseID:FBgn0031930 Length:429 Species:Drosophila melanogaster

Alignment Length:387 Identity:132/388 (34%)
Similarity:218/388 (56%) Gaps:13/388 (3%)


  Fly   722 RYDGAQVWRIVVQTDKDKRMADEL-QSKYDGQLWKEVKQEVDYLLKPQVLAAAERHIRAANLSRI 785
            |||...|:::..:|...:.:..:| :.:.:.:||.|.|.|:..:|.|......|..|:..|::..
  Fly    28 RYDNYSVYKVKFETQAQRSILRKLAEDRENFRLWHEAKDELHLMLSPGAFGELETEIQKTNVTAE 92

  Fly   786 VLIDNLQRVIEKENPPAEKIAELQNRKGHRLTWQAYHRLEDIHGFIDYMAKTYPDICSTEIIGYS 850
            :.|.|:|.:|:     :|:.|.|:..:.....|..|:.|.:|:.::|.:...||.|..:.|:|.|
  Fly    93 LFISNVQELID-----SEEAANLKASRDGTFGWTKYNSLAEIYAWLDDILAAYPTITESFIVGQS 152

  Fly   851 VEKRPLKILKISNGNARNPGIWIDGGMHAREWISPATVTYIANQLVEGWEDLPEHM-RSINWYIH 914
            .|.|.::.:|||. .:.|||:.|:..:||||||:.||.|::.|:.:...::|...: .:.:|||.
  Fly   153 YEGRTIRGIKISY-KSNNPGVLIESNIHAREWITSATATWLINEFLTSTDELVRDLAENHDWYIV 216

  Fly   915 PVANPDGYEYSHTTDRLWRKNMR-AHGRQCPGVDLNRNFGYKW-GGKGTSASPCSQTYRGSKAFS 977
            ||.|.||:.|:|..||:|||..: :....|.|.|.|||:...| ..:|.|::||::.|.|.|.||
  Fly   217 PVLNVDGFVYTHEKDRMWRKTRQPSEISSCIGADPNRNYDSHWMENEGASSNPCAEDYGGPKPFS 281

  Fly   978 EPETFYISKFISGFPRETFQAYLSFHSYGQYILYPWGY-DYQLTQDRADLDRVARQAGTSI-TKS 1040
            |||...:|:|:... ::.....|:||||.|.:|.|:|: ..:...:..|:..||:..|.:: :..
  Fly   282 EPEIQAMSEFVISI-KDKINVLLAFHSYSQLLLSPYGHTKEEFPPNFDDMMEVAKAYGDAVESLP 345

  Fly  1041 TGVKYTVGSSATTLYPAAGGSDDWAKGIAGIKYAYTIEMGDTGRYGFVLPARFIQYNGKDGV 1102
            .|..|..||:|..||||:|.:.|||....|::.:||||..|||||||:||...|..|.::.:
  Fly   346 YGTVYRYGSAAGILYPASGATIDWAYNEQGVEISYTIEFRDTGRYGFILPPVHIIPNAEEAL 407

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG3108NP_572262.1 Propep_M14 730..797 CDD:280416 16/68 (24%)
M14_CP_A-B_like 821..1112 CDD:199844 108/288 (38%)
CG7025NP_609133.2 Propep_M14 36..103 CDD:280416 16/67 (24%)
M14_CP_A-B_like 123..416 CDD:199844 108/288 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C71060173
eggNOG 1 0.900 E1_COG2866
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D208397at33208
OrthoFinder 1 1.000 FOG0000073
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR11705
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1730
65.970

Return to query results.
Submit another query.