DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG3108 and CG8945

Sequence 1:NP_572262.1 Gene:CG3108 FlyBaseID:FBgn0029807 Length:1132 Species:Drosophila melanogaster
Sequence 2:NP_573190.1 Gene:CG8945 FlyBaseID:FBgn0030815 Length:1430 Species:Drosophila melanogaster

Alignment Length:1296 Identity:269/1297 (21%)
Similarity:467/1297 (36%) Gaps:319/1297 (25%)


  Fly    32 LNQV------ASMSLDRLALERNELPADQQQQQQQDVLVDNMKLTSIPSADSSDMYMLVPDTVAS 90
            ||.|      |...:.||...:|.:.....:..:.:.....:.:||.|....||..:.:|....|
  Fly   215 LNPVHHGGTTARPQIIRLKKPKNPITKPSNKLPKPNYRPPPVMVTSGPIDHVSDQLLKLPHRTGS 279

  Fly    91 QLEDT-----------------EHVNRNSIE---------ADPESDPSGS--------SSSDMLM 121
            ....|                 :.:.:|..:         |:....|.||        .|:....
  Fly   280 TTRSTTTTTSTTSRPNTRRKKRKKIPKNKTKVIKKRPGYGANNTRGPQGSLPIILGKRPSTTTTT 344

  Fly   122 LESDSSPAMQLVELP--SDITVAESQPETEHDTEND---QQQPESIEEHVVLMKPASQEAQLEQT 181
            ..|...||...:|.|  ...|:..|...::|...:|   .::.|::||...|........::.::
  Fly   345 TTSRPPPAYTQLEKPHMPQATLPTSNVFSQHLLRSDLEPAEESETLEEQEPLQSDEQLNLRIRRS 409

  Fly   182 V-DLATEAAPVPLNDELPEDEESPAATESAVEELEKESEAAMDDQVPEESEIQPEQ-------VQ 238
            | |:..|....||:.:...........:|.::...|.:....:....:.|..|..:       ::
  Fly   410 VEDVRREKRRGPLHAKKRNSSLKALIKKSVLKNAVKRARLLKNQGEMDSSRTQHRRSRRSLYSIK 474

  Fly   239 PGEYQSESDGEQAETKPEIEAQPEVEAQPEAEAQ----PEAEPQLEVEPQPEVESQPEVESQPEV 299
            .||.:.....|:|...|..||:.||.|.....:|    .|::..|.       ...|.|.:...|
  Fly   475 NGEIEKSIKTEKATKVPSEEAEKEVTADSTKRSQKVVSKESKTILS-------RGNPNVVAARRV 532

  Fly   300 EAQPEVEPQSEVESQPEAESHSEPETQAEVEAQPEVESLPEA-------ESQPEAESQPEREPEV 357
            .......|:.. ..:.:.:..:.|.||.:.:....|..:|.|       .||.|....|....:.
  Fly   533 STPKRRSPKGS-SGRRKTKQQTPPSTQKKEKNSGGVLHIPTALHLLHRNHSQDEVPKVPLNANQK 596

  Fly   358 EAEKISDNEVDTTEASLMETLVEGIEDGLTAAMDNLVPEELAEASDKQ----ETELESEDQQSPV 418
            :..|:.:.:....:....: :.|.:.||   ..::...||..|..|.:    |.|.:.||:..| 
  Fly   597 KKRKVKERKRGRPQLPSFD-IFELMSDG---DYEDEGEEEEEEQDDDEDYYFEDEHKDEDKNKP- 656

  Fly   419 TEAIEEQAVPEIEQEKEKEPEQ---------ITLADETEQDSAQPSNEE---------------- 458
                .|.:..|:.|...||...         ..:.:||...:...|:||                
  Fly   657 ----NESSSTEVGQSDLKEDSSSAEEGADFGAMVEEETTTTATISSSEELDATSSTKNSMAKKKI 717

  Fly   459 -----PVEIAPEQHTEAE----------------IAPAKIPEE-GKPEEEVQVEEESKPVEE--- 498
                 ||: :.|.:.:.|                :|.:::.:. |.|:||...|..::||.:   
  Fly   718 RIKRRPVD-SDEDYDDDEDSGIAGFFRMIFYPVQVAMSRLMDGFGTPDEEEDKEPATQPVSKYPS 781

  Fly   499 -----SKPEEEIKQQEDAKPEEDDQNYAE----------TQPAVTEVKPEETPADIPVEIPAEVP 548
                 |....|...:.|.:..|||::.:.          .|....::....|...:|:..|.:.|
  Fly   782 YTLYHSAHSNEAYAEPDDEDSEDDEDSSSLGSWFGSWFGLQRRTKKIGSTTTTMPVPLPPPTKAP 846

  Fly   549 AEIPAEIPAEVPAEIPAESPAEIAAE------VPAEIPAEIPAEIPAETPAETHAEIPADVPAQV 607
                   |:.:.:.....|..|..||      ..:...:....:....:...|            
  Fly   847 -------PSWLESWFGFGSTTEADAEDDYDKWFSSWFDSRPKRKFRRRSTTST------------ 892

  Fly   608 VAEAPAETPAETPAEVPAEIPSKVQDEIQSDSTQAEPQVEKEAQQPEKETKPLESSLLTTIIPMV 672
             :.....|...||:...|::|                                   :||.:.|:.
  Fly   893 -STTSTTTTTHTPSAAAAQVP-----------------------------------ILTIVDPLR 921

  Fly   673 MPQPQV------------------PSQP-LQVQDSVLNYVNASFMQQQPSETDLPKTEEESPFNA 718
            .||..:                  .|.| ||...:.:.....:......|..|:|          
  Fly   922 NPQNWIGILAHHIVNSTGSAISTSTSNPLLQALATRMTTRGTTSTTTTTSRPDVP---------- 976

  Fly   719 HLRR--YDGAQVWRIVVQTDKDKRMADELQSKYDGQLWKEVKQE-----VDYLLKPQVLAAAERH 776
              ||  ||..|:||:..|.::..|..:|.:...||...:.:|..     .|.|:.|::|...:..
  Fly   977 --RRISYDKYQIWRLKPQDEEQVRALEEFKKGEDGVKLQWLKGPSLRGLTDVLVPPKMLVDFQGT 1039

  Fly   777 IRAANLSRIVLIDNLQRVIEKENPPAEKIAELQNRKGHR--------LTWQAYHRLEDIHGFIDY 833
            :....::..|||.::.:.|..|   ..|...||..:..:        :||..||..::|..:::.
  Fly  1040 LNYEGIAHEVLIFDVGKAIAYE---LTKEDYLQTTRPSKPRPTAPPPMTWNRYHNHDEIVKYLET 1101

  Fly   834 MAKTYPDICSTEIIGYSVEKRPLKILKISN----GNARNPG------------------IWIDGG 876
            :...:|.:.....||.|.|.|||.::||.:    ..|.|.|                  ::::.|
  Fly  1102 VRMRHPQLVELIHIGRSFEGRPLIVVKIESKQTAAAANNDGLHTIKRPKRKRKSGQANAVFVEAG 1166

  Fly   877 MHAREWISPATVTYIANQLV------EGWEDLPEHMRSINWYIHPVANPDGYEYSHTTDRLWRKN 935
            .....||.||..|::..:|:      :..||: |.:|:..|||.||.|||||.|||..||.|:|:
  Fly  1167 AQGLAWIGPAAATWMIAELLRLMKTNKSNEDV-EFIRNTTWYIMPVLNPDGYAYSHEYDRFWKKS 1230

  Fly   936 MRAH----------------------GRQCPGVDLNRNFGYKWGGKGTSASPCSQTYRGSKAFSE 978
            ...|                      .:.|.||||:||:.|.||.:|:|.:||::.|.|...|||
  Fly  1231 RSQHQTPPPSGLLDSAMTWLQQKRGPDKVCYGVDLDRNWLYHWGKRGSSKAPCNEFYAGPAPFSE 1295

  Fly   979 PETFYISKFISGFPRETFQAYLSFHSYGQYILYPWGYDYQLTQDRAD--LDRVARQAGTSITKST 1041
            |||..:|:|:..: |...:.|:|..:|||.|.||...:.....:|.|  ||  ....||...:..
  Fly  1296 PETKAVSEFLMDY-RTQIKLYISLQAYGQVISYPVKANSTFNSERLDDFLD--VAMVGTDGLRKK 1357

  Fly  1042 GVK--YTVGSSATTLYPAAGGSDDWAKGIAGIKYAYTIEMGDTGRYGFVLPARFIQYNGKD 1100
            |.|  |.|.:|...:...:|.:|.:|....||.::||:::.|.|.:|::||:..|:...:|
  Fly  1358 GSKSRYKVDASNDLIEQRSGCADAFAAYEIGIPFSYTLQLADNGVHGYLLPSSAIEPTARD 1418

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG3108NP_572262.1 Propep_M14 730..797 CDD:280416 15/72 (21%)
M14_CP_A-B_like 821..1112 CDD:199844 103/335 (31%)
CG8945NP_573190.1 Propep_M14 988..1058 CDD:280416 14/70 (20%)
M14_CP_A-B_like 1089..1430 CDD:199844 103/335 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG2866
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D208397at33208
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR11705
RoundUp 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.