DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG3108 and cpb1

Sequence 1:NP_572262.1 Gene:CG3108 FlyBaseID:FBgn0029807 Length:1132 Species:Drosophila melanogaster
Sequence 2:NP_001315354.1 Gene:cpb1 ZFINID:ZDB-GENE-030131-1132 Length:416 Species:Danio rerio

Alignment Length:381 Identity:133/382 (35%)
Similarity:201/382 (53%) Gaps:28/382 (7%)


  Fly   725 GAQVWRIVVQTDKDKRMADELQSKYDGQLWK-------EVKQEVDYLLKPQVLAAAERHIRAANL 782
            |.:|.::....|:...:..||..|.....||       .:...||..:....||.....::.:::
Zfish    22 GDKVLQLKPINDEHVTIIRELGEKIKLDFWKPRSADLVSIDMTVDIHVPAAQLAMVSTILQQSDM 86

  Fly   783 SRIVLIDNLQRVIEKENPPAEKIAELQNR---KGHRLTWQAYHRLEDIHGFIDYMAKTYPDICST 844
            ...|:|||||..::         .::.||   |||..|  .|:....|:.:...::...||:.|.
Zfish    87 EVKVMIDNLQEAVK---------GQMDNRSPTKGHDYT--KYNSWATINDWAISISSANPDLISR 140

  Fly   845 EIIGYSVEKRPLKILKI-SNGNARNPGIWIDGGMHAREWISPATVTYIANQLVEGW---EDLPEH 905
            :.||.:.|.|.:.:||| .|..:..|.:::|.|.||||||:.|...:..|:.|..:   .|:...
Zfish   141 QSIGNTYEGRTMHLLKIGKNTGSNKPAVFMDCGFHAREWITHAFCQWFVNEAVSTYGSDPDMTNL 205

  Fly   906 MRSINWYIHPVANPDGYEYSHTTDRLWRK-NMRAHGRQCPGVDLNRNFGYKWGGKGTSASPCSQT 969
            :..:::::.||.|.|||||:...||:||| ..:..|..|.|.|.||||...|...|.|::|||.|
Zfish   206 LDRMDFFVLPVFNIDGYEYTWNRDRMWRKTRSKNSGSSCIGTDPNRNFNAGWCTVGASSNPCSDT 270

  Fly   970 YRGSKAFSEPETFYISKFISGFPRETFQAYLSFHSYGQYILYPWGYDYQLTQDRADLDRVARQAG 1034
            |.||...||.|:..::.||. ..:...:|||:.|||.|.:|:|:.|.|.|....::|..|::.|.
Zfish   271 YCGSSPESEIESKNLANFIR-TNKSVIKAYLTVHSYSQLLLFPYSYKYDLAAHHSELMSVSQGAI 334

  Fly  1035 TSITKSTGVKYTVGSSATTLYPAAGGSDDWAKGIAGIKYAYTIEMGDTGRYGFVLP 1090
            .::....|.|||.|..|.|:|||||||||||..: |:||:||.|:.|.|||||:||
Zfish   335 AALRSLYGTKYTSGPGAATIYPAAGGSDDWAYDL-GVKYSYTFELRDEGRYGFLLP 389

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG3108NP_572262.1 Propep_M14 730..797 CDD:280416 16/74 (22%)
M14_CP_A-B_like 821..1112 CDD:199844 109/276 (39%)
cpb1NP_001315354.1 Propep_M14 27..99 CDD:280416 16/72 (22%)
M14_CPB 112..412 CDD:199852 111/283 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG2866
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D208397at33208
OrthoFinder 1 1.000 FOG0000073
OrthoInspector 1 1.000 T128829
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.632 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1730
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.