DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG3108 and T24E12.10

Sequence 1:NP_572262.1 Gene:CG3108 FlyBaseID:FBgn0029807 Length:1132 Species:Drosophila melanogaster
Sequence 2:NP_494646.2 Gene:T24E12.10 WormBaseID:WBGene00020777 Length:1318 Species:Caenorhabditis elegans

Alignment Length:1289 Identity:253/1290 (20%)
Similarity:430/1290 (33%) Gaps:438/1290 (34%)


  Fly    99 NRNSIEADPESDPSGSSSSDMLMLESDSSPAMQLVE----LPSDITVAESQPETEHDTENDQQQP 159
            |.|.:|.||....:.::....|.|...::...:|.|    ..:.:.|..::|..|...:.:|...
 Worm     4 NHNPVEQDPVELATAAARDLNLNLVQGTAQENRLFEHGQNTEAPVEVQGAEPNQEMSQDANQGSL 68

  Fly   160 ESIEEHVVLMKPA-----SQEAQLEQT---VDLATEAAP-------VP---LNDELPEDEES--- 203
            ||  ||..:..|.     ||..:|.:.   :|...|.||       ||   ...::.:.:::   
 Worm    69 ES--EHKKVTFPGLDVYFSQIGELFKVSGILDAPIEPAPQKKKPNRVPNYKSKRKIQKKKKNIPV 131

  Fly   204 PAATESA------------VEELEKESEAA---------------MDDQVPEESEIQPEQVQPGE 241
            |..|.||            ..::...|||.               :||.||.||      |.|.|
 Worm   132 PTYTRSARRSTKSQRNLWQTNDVSSTSEATRIQEPIDWITLSDCDLDDDVPGES------VAPLE 190

  Fly   242 YQSESDGEQAETKPEIEAQPEVEAQPEAEAQPEAEPQLEVEPQPEVESQPEVESQPEVEAQPEVE 306
            .....|...|..     |:|   :...|..:...||| ||.|.|||:...|.:....:.....||
 Worm   191 LAQNCDDVVAPI-----AEP---SSSSANHEASLEPQ-EVSPLPEVQGDLEKDDHDHLLPDDSVE 246

  Fly   307 PQS-----EVESQPEAESH-----------SEPETQAEVE--------------AQPEVESLPEA 341
            ||:     ||:.....:.|           .||....||:              |.|...|:.:.
 Worm   247 PQNGPTSLEVQGCEAEDGHDHEFCVNSVVPQEPSPSPEVQDDQTEDAQQFSVSSAVPIAPSIGKD 311

  Fly   342 ESQPEAESQPE-REPEVEA-------------------EKISDNEVDTTEA----SLMETLVEGI 382
            :||.|..::.: .||||:|                   |.::..||...||    .|....|..:
 Worm   312 DSQHEMSAEVQSMEPEVQADFAKDFHDHVSCVNSVVPHEPVNSQEVQDYEAEDDNDLSAQSVAPV 376

  Fly   383 EDGLTAAMDNLVPEEL--------------------AEASDKQETE---LESEDQQ--------- 415
            .:..::|..: .|:|:                    ||.||.:.|:   :|:.|..         
 Worm   377 AESFSSATTS-EPQEIVEIQEHHAAHQLPAVSVATFAETSDNKATDEMSMEAPDDHQFSIHWVSN 440

  Fly   416 ------SP-----VTEAIEEQAVPEIEQE-------------KEKEPEQITLADETEQDSAQPSN 456
                  ||     :.:.:|....||:...             |.||..|.|...|.:.:.|.|| 
 Worm   441 FEEISFSPDGYNSLMDPLETSQSPEVRDYVNEDGHDFCDSLIKPKELSQSTKVREAQAEDAAPS- 504

  Fly   457 EEPVEIAPEQHTEAEIAPAKIPEEGKPEEEVQVEEE----SKPVEESKPEEEIKQQEDAK-PE-- 514
                 ::|  :.||.:|    .:|...|..|:|:|:    |.|.....|   |:|||.:: ||  
 Worm   505 -----VSP--NYEASLA----SDEALCEIVVEVQEDRQFSSSPASHDAP---IEQQETSQSPENQ 555

  Fly   515 ---EDDQNYAETQPAVTEVKP----EETPADIPVEIPAEVPAEIPAEIP--------AEVPAEIP 564
               :::.::..|| :|..||.    :|||.:|..|:......|.|...|        ||:..:..
 Worm   556 YDIDEEAHHLSTQ-SVAPVKAFLANDETPHEISAEVHDNHQVESPEPSPSPDVQNGQAEIEQQYS 619

  Fly   565 AESPAEIAAEVP----------------------AEIPAEIPAEIPAETPAET---HAEIPADVP 604
            |:|     ||.|                      ::||...|  ||.:...||   ...||.:.|
 Worm   620 ADS-----AEPPLSESLKMAPVVEGRAAQQLSTVSDIPIAKP--IPVKLSTETLLRQQGIPLNFP 677

  Fly   605 AQVV-----AEAPAETPAETPAEVPAEIPSKVQDEIQSDSTQAEPQVEKEAQQPEKET------- 657
            ...:     .||...|.|..|..         |.|.|:.|.||.|::...|:....::       
 Worm   678 VHSIFPTTFHEALLNTCAGQPEN---------QVEKQNFSFQAVPEMPSSAEVQGSQSGHQFFAH 733

  Fly   658 ---KPLESSLLTTIIPMVMPQ---------PQVPSQPLQVQDSVLNYVNASFMQQQPSETDLPKT 710
               :|..|:.:..|....|.|         |.....|:....|.....|..|::.|.::.     
 Worm   734 PVAEPAISAFVYNIYAQQMTQFKNLAINNIPGYSGAPVAKPSSYATANNNIFLEHQLAQQ----- 793

  Fly   711 EEESPFNAHLRRYDGAQVWRIV----VQTDKDKRMADELQSKYD------------GQLWKEVKQ 759
                  |.|  :..|:.|..:|    ..|..|....::..::.:            .|.::.::|
 Worm   794 ------NTH--QISGSLVGPLVGPPFSATANDAMPENQPAAQQNLFSHPYALLEQPPQKYQNLEQ 850

  Fly   760 EVDYLLKPQVLAAAERHIRAANLSRIVLIDNLQRVIEKENPPAEKIAELQNRKGHRLTWQAYHRL 824
            :   |::|.:|:           ::.:|....|.:...:....::|..|.|..  :|...|....
 Worm   851 Q---LVRPVILS-----------TQNLLFKPFQPLNNDQTLINQQIVNLPNFP--KLLQVAVEHF 899

  Fly   825 EDIHGFIDYMAKTYPDICSTEI----------IGYSVEKRPLKILKISNGNARNPGIWIDGGMHA 879
            :.....:.::.|.:..|.::|.          .|.:....|.::..|.|.:     :::  .|| 
 Worm   900 DPGSASLSFVKKFFVKIETSESRKENFQLILEFGQTRSSPPSQVPYIPNSS-----VFV--YMH- 956

  Fly   880 REWISPATVT-------YIANQLVEGWEDLPEHMRSINWYIHPVANPDGYEYSHTTDRLWRKNMR 937
            ||:.:.::..       :||.|.:....|:  .::.:||..               || |:.:..
 Worm   957 REFNTASSCQEYRTQYFFIAGQRILFCFDV--ELQPLNWRF---------------DR-WKVDSS 1003

  Fly   938 AHGRQ-----CPGV-------------------DLNRNFGYKW----------GGKGT------- 961
            ..|.|     |..:                   |:..||..::          |.:.|       
 Worm  1004 GRGAQISLHTCDTINFMGPAFPKTGYHTIRITKDMIYNFQKEFTYIFPECQIAGNRSTTPEEQGE 1068

  Fly   962 -SASPC-------SQTYRGSKAFSEPETFYISKFISGFPRETFQAYLSFHSYGQYILYPWGYDYQ 1018
             |:.|.       :|....|...||..|..:|...:.||.|:..                 :|::
 Worm  1069 QSSGPTISSDGNEAQLIPNSATSSEGSTSSVSPADAAFPPESTP-----------------FDHK 1116

  Fly  1019 LTQDRADLDRVARQAGTSITKSTGVKYTVGSSATTLYPAAGGSDDWAKGIAGIK 1072
            :......|.:.:.|..:|.....||......:.::.|....|..| |.|.:.:|
 Worm  1117 IQTIPLLLSQFSTQGSSSFEPRRGVSSAPDHATSSRYCHKFGRPD-APGPSTLK 1169

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG3108NP_572262.1 Propep_M14 730..797 CDD:280416 10/83 (12%)
M14_CP_A-B_like 821..1112 CDD:199844 51/319 (16%)
T24E12.10NP_494646.2 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.