DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG3108 and CPO

Sequence 1:NP_572262.1 Gene:CG3108 FlyBaseID:FBgn0029807 Length:1132 Species:Drosophila melanogaster
Sequence 2:NP_775100.1 Gene:CPO HGNCID:21011 Length:374 Species:Homo sapiens

Alignment Length:315 Identity:112/316 (35%)
Similarity:179/316 (57%) Gaps:18/316 (6%)


  Fly   787 LIDNLQRVIEKENPPAEKIAELQNRKGHRLTWQAYHRLEDIHGFIDYMAKTYPDICSTEIIGYSV 851
            |..:.|.:::|...|...         ...::..||.:.:|:.::..:::.|.::.:...:|.:.
Human    25 LAQHRQEIVDKSVSPWSL---------ETYSYNIYHPMGEIYEWMREISEKYKEVVTQHFLGVTY 80

  Fly   852 EKRPLKILKIS--NGNARNPGIWIDGGMHAREWISPATVTYIANQLVEGWED---LPEHMRSINW 911
            |..|:..||||  :||.:.. ||:|.|:||||||:||...:...::::..:|   :.:.:|::::
Human    81 ETHPMYYLKISQPSGNPKKI-IWMDCGIHAREWIAPAFCQWFVKEILQNHKDNSSIRKLLRNLDF 144

  Fly   912 YIHPVANPDGYEYSHTTDRLWRKNMRAHGR-QCPGVDLNRNFGYKWGGKGTSASPCSQTYRGSKA 975
            |:.||.|.|||.|:.||||||||:...|.. .|.|.||||||...|...|.|.:...||:.|:..
Human   145 YVLPVLNIDGYIYTWTTDRLWRKSRSPHNNGTCFGTDLNRNFNASWCSIGASRNCQDQTFCGTGP 209

  Fly   976 FSEPETFYISKFISGFPRETFQAYLSFHSYGQYILYPWGYDYQLTQDRADLDRVARQAGTSITKS 1040
            .|||||..::.||.. .::....:|:.|||||.||.|:||....:.:..::.:|.::|..::...
Human   210 VSEPETKAVASFIES-KKDDILCFLTMHSYGQLILTPYGYTKNKSSNHPEMIQVGQKAANALKAK 273

  Fly  1041 TGVKYTVGSSATTLYPAAGGSDDWAKGIAGIKYAYTIEMGDTGRYGFVLPARFIQ 1095
            .|..|.|||||..||.::|.|.|||:.| ||.::||.|:.|:|.||||||...||
Human   274 YGTNYRVGSSADILYASSGSSRDWARDI-GIPFSYTFELRDSGTYGFVLPEAQIQ 327

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG3108NP_572262.1 Propep_M14 730..797 CDD:280416 2/10 (20%)
M14_CP_A-B_like 821..1112 CDD:199844 108/282 (38%)
CPONP_775100.1 M14_CPO 47..344 CDD:133105 108/285 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C70637198
eggNOG 1 0.900 E1_COG2866
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D208397at33208
OrthoFinder 1 1.000 FOG0000073
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.632 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1730
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
65.780

Return to query results.
Submit another query.