DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG3108 and Cpa1

Sequence 1:NP_572262.1 Gene:CG3108 FlyBaseID:FBgn0029807 Length:1132 Species:Drosophila melanogaster
Sequence 2:NP_079626.2 Gene:Cpa1 MGIID:88478 Length:419 Species:Mus musculus

Alignment Length:385 Identity:130/386 (34%)
Similarity:212/386 (55%) Gaps:31/386 (8%)


  Fly   725 GAQVWRIVVQTDKDKRMADELQS----KYDGQLWKE-------VKQEVDYLLKPQVLAAAERHIR 778
            |.||.||....:...:...||:.    |.|  .|::       :...|.:.....|.|..|.|  
Mouse    22 GHQVLRISATDEAQVQKVRELEELEHLKLD--FWRDPARAGLPIDVRVPFPTIQSVKAFLEYH-- 82

  Fly   779 AANLSRIVLIDNLQRVIEKENPPAEKIAELQNR--KGHRLTWQAYHRLEDIHGFIDYMAKTYPDI 841
              ::|..::|:::|.::::|.   ::::..|.|  ......:..||.|::|:.|:|.:...:|.:
Mouse    83 --DISYEIMIEDVQSLLDEEK---QQMSAFQARALSTDAFNYATYHTLDEIYEFMDLLVTEHPQL 142

  Fly   842 CSTEIIGYSVEKRPLKILKISNGNARNPGIWIDGGMHAREWISPATVTYIANQLVEGWEDLP--- 903
            .|...||.:.|.||:.:||.|.|....|.||||.|:|:|||::.|:..:.|.::.:.:...|   
Mouse   143 VSKIQIGSTFEGRPINVLKFSTGGTNRPAIWIDTGIHSREWVTQASGVWFAKKITKDYGQEPTLT 207

  Fly   904 EHMRSINWYIHPVANPDGYEYSHTTDRLWRKNMRAH--GRQCPGVDLNRNFGYKWGGKGTSASPC 966
            ..:.:::.::..|.||||:.|:|.|:|:|||. |:|  |..|.|||.|||:...:|..|.|::||
Mouse   208 AILDNMDIFLEIVTNPDGFVYTHKTNRMWRKT-RSHTEGSLCVGVDPNRNWDAAFGMPGASSNPC 271

  Fly   967 SQTYRGSKAFSEPETFYISKFISGFPRETFQAYLSFHSYGQYILYPWGYDYQLTQDRADLDRVAR 1031
            |:||||....||.|...|..|::.  ....:|::|.|||.|.:|||:||..:...|:.:||::|:
Mouse   272 SETYRGKFPNSEVEVKSIVDFVTS--HGNIKAFISIHSYSQLLLYPYGYTSEPAPDKEELDQLAK 334

  Fly  1032 QAGTSITKSTGVKYTVGSSATTLYPAAGGSDDWAKGIAGIKYAYTIEMGDTGRYGFVLPA 1091
            .|.|::|...|.|:..||...|:|.|:|.:.||... .||||::|.|:.|||..||:|||
Mouse   335 SAVTALTSLHGTKFKYGSIIDTIYQASGSTIDWTYS-QGIKYSFTFELRDTGLRGFLLPA 393

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG3108NP_572262.1 Propep_M14 730..797 CDD:280416 15/78 (19%)
M14_CP_A-B_like 821..1112 CDD:199844 109/277 (39%)
Cpa1NP_079626.2 Propep_M14 27..99 CDD:280416 15/78 (19%)
M14_CPA 117..417 CDD:133081 109/282 (39%)
Substrate binding. {ECO:0000250|UniProtKB:P00730} 179..182 2/3 (67%)
Substrate binding. {ECO:0000250|UniProtKB:P00730} 254..255 1/1 (100%)
Substrate binding. {ECO:0000250|UniProtKB:P00730} 307..308 1/1 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C69903491
eggNOG 1 0.900 E1_COG2866
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D208397at33208
OrthoFinder 1 1.000 FOG0000073
OrthoInspector 1 1.000 T131054
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.638 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1730
TreeFam 00.000 Not matched by this tool.
76.780

Return to query results.
Submit another query.