DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG3108 and cpo

Sequence 1:NP_572262.1 Gene:CG3108 FlyBaseID:FBgn0029807 Length:1132 Species:Drosophila melanogaster
Sequence 2:NP_001120207.1 Gene:cpo XenbaseID:XB-GENE-989447 Length:382 Species:Xenopus tropicalis

Alignment Length:317 Identity:110/318 (35%)
Similarity:180/318 (57%) Gaps:14/318 (4%)


  Fly   786 VLIDNLQRVIEKENPPAEKIAELQNRKG--HRLTWQAYHRLEDIHGFIDYMAKTYPDICSTEIIG 848
            |:|.::|::|:..|     :.:.:.:|.  ....:..||.:::|:.::|.:.:.|.|:.|...:|
 Frog    26 VMIKDVQKLID
SSN-----VGDYRRQKKILAEFDYTTYHPMDEIYQWMDQVKEAYSDLVSMHYLG 85

  Fly   849 YSVEKRPLKILKIS-NGNARNPGIWIDGGMHAREWISPATVTYIANQLVEGWEDLP---EHMRSI 909
            .:.|.||:...||. ..:.:...||:|.|:||||||:.|...:...:::|..:..|   :.:.:|
 Frog    86 STYELRPIYYFKIGWPSDKQKKIIWMDCGIHAREWIAVAYCQWFVKEILETHKTNPLLQKVLHNI 150

  Fly   910 NWYIHPVANPDGYEYSHTTDRLWRKNMRAHGR-QCPGVDLNRNFGYKWGGKGTSASPCSQTYRGS 973
            ::||.||.|.||:.||...:|||||:...|.. .|.||||||||..|||..|.|.:...:||.|:
 Frog   151 DFYIVPVLNIDGFVYSWNVNRLWRKSRSPHNNGSCYGVDLNRNFNSKWGSIGASNNCRDETYCGT 215

  Fly   974 KAFSEPETFYISKFISGFPRETFQAYLSFHSYGQYILYPWGYDYQLTQDRADLDRVARQAGTSIT 1038
            ...||||...:||.:.....:.. .:|:.|||||.:|.|:||....:.:..::..||::|...:.
 Frog   216 GPASEPEVNAVSKLLGSLKSDVL-CFLTIHSYGQLLLLPYGYTKDPSINHEEMINVAQKAAAKLQ 279

  Fly  1039 KSTGVKYTVGSSATTLYPAAGGSDDWAKGIAGIKYAYTIEMGDTGRYGFVLPARFIQ 1095
            :..|.:|.|||::..||..:|.|.|||..: ||.::||.|:.|||.:||:|||..|:
 Frog   280 EKHGTEYRVGSTSHLLYSNSGSSRDWATDL-GINFSYTFELRDTGAHGFILPANQIR 335

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG3108NP_572262.1 Propep_M14 730..797 CDD:280416 4/11 (36%)
M14_CP_A-B_like 821..1112 CDD:199844 104/281 (37%)
cpoNP_001120207.1 Propep_M14 <1..36 CDD:280416 4/10 (40%)
Peptidase_M14_like 55..352 CDD:299699 104/284 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C70628586
eggNOG 1 0.900 E1_COG2866
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D208397at33208
OrthoFinder 1 1.000 FOG0000073
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1730
TreeFam 00.000 Not matched by this tool.
54.870

Return to query results.
Submit another query.