DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG3097 and CPA5

Sequence 1:NP_572259.1 Gene:CG3097 FlyBaseID:FBgn0029804 Length:445 Species:Drosophila melanogaster
Sequence 2:NP_001120913.1 Gene:CPA5 HGNCID:15722 Length:436 Species:Homo sapiens

Alignment Length:450 Identity:140/450 (31%)
Similarity:223/450 (50%) Gaps:53/450 (12%)


  Fly     3 QKTMLLQLLLLVAA----------VAASLANELPSNLTLLDANE--IPQRYDEAQLWRIYNISEA 55
            ::|:|:...:|.||          |...||.: ...|:||...|  .||:.|   .||     ..
Human    18 RRTLLVFSFILAAALGQMNFTGDQVLRVLAKD-EKQLSLLGDLEGLKPQKVD---FWR-----GP 73

  Fly    56 MQKRVPVGQMLEQKFGGNIWKENSKFLDISIARDQLKAARSFLSAHRLDPQILSHNIQSMIDEEL 120
            .:..:||                    |:.:...:||..:::|.:|.|...|:..:||.::||| 
Human    74 ARPSLPV--------------------DMRVPFSELKDIKAYLESHGLAYSIMIKDIQVLLDEE- 117

  Fly   121 LEGIQSSSFGHGRRTKKAARSSMHWKDYHDLETIYSFMREIRTKFPNIVRLYTIGQTAEGRDLKV 185
                 ..:....||.:::. :|..:..||.||.|||::.....:..:||....||.:.|.:.:.|
Human   118 -----RQAMAKSRRLERST-NSFSYSSYHTLEEIYSWIDNFVMEHSDIVSKIQIGNSFENQSILV 176

  Fly   186 LRISENPRENKKVWIDGGIHAREWISPATVTFILYQLMSDWENQPA---HIRGLTWYIMPVMNPD 247
            |:.|.....:..:|||.|||:||||:.||..:...:::||:.....   .:..:..:|..|.|||
Human   177 LKFSTGGSRHPAIWIDTGIHSREWITHATGIWTANKIVSDYGKDRVLTDILNAMDIFIELVTNPD 241

  Fly   248 GYEYSRTTNRLWRKNRSPSRRAQCSGVDLNRNFDIGWNGYGSSTNPCSDTYRGSAPASERETRAV 312
            |:.::.:.|||||||:|......|.|||||||:..|:.|.||::||||:||.|.:|.||.|..|:
Human   242 GFAFTHSMNRLWRKNKSIRPGIFCIGVDLNRNWKSGFGGNGSNSNPCSETYHGPSPQSEPEVAAI 306

  Fly   313 AEFLAKRKYNLESYLTFHSYGQMIVYPWAYKAVKVKDASVLQRVSSLAAERILQKTGTSYRAAVT 377
            ..|:.... |.::.::.|||.||::||:......|.:...|..::..|.|.:.:..|..|.....
Human   307 VNFITAHG-NFKALISIHSYSQMLMYPYGRLLEPVSNQRELYDLAKDAVEALYKVHGIEYIFGSI 370

  Fly   378 HEVLGIAGGGSDDWSRAALGVKYVYTIELRDRGAYGFVLPPRFIKDTALEGWTVVETVAQ 437
            ...|.:|.|.:.||:..: |:||.::.||||.|.|||:||...|..||.|.|..:.|:.:
Human   371 STTLYVASGITVDWAYDS-GIKYAFSFELRDTGQYGFLLPATQIIPTAQETWMALRTIME 429

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG3097NP_572259.1 Propep_M14 64..118 CDD:280416 10/54 (19%)
M14_CP_A-B_like 148..439 CDD:199844 106/293 (36%)
CPA5NP_001120913.1 Propep_M14 43..117 CDD:308061 24/103 (23%)
Peptidase_M14_like 134..434 CDD:325013 106/298 (36%)
Substrate binding. {ECO:0000250|UniProtKB:P00730} 196..199 2/3 (67%)
Substrate binding. {ECO:0000250|UniProtKB:P00730} 271..272 1/1 (100%)
Substrate binding. {ECO:0000250|UniProtKB:P00730} 324..325 1/1 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C71155676
eggNOG 1 0.900 E1_COG2866
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D208397at33208
OrthoFinder 1 1.000 FOG0000073
OrthoInspector 1 1.000 T130287
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.645 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
76.750

Return to query results.
Submit another query.