DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG3097 and cpb2

Sequence 1:NP_572259.1 Gene:CG3097 FlyBaseID:FBgn0029804 Length:445 Species:Drosophila melanogaster
Sequence 2:NP_001025617.1 Gene:cpb2 XenbaseID:XB-GENE-969491 Length:421 Species:Xenopus tropicalis

Alignment Length:381 Identity:143/382 (37%)
Similarity:209/382 (55%) Gaps:30/382 (8%)


  Fly    74 IWKENS-------KFLDISIARDQLKAARSFLSAHRLDPQILSHNIQSMIDEELLEGIQSSSFGH 131
            :||.:|       |.:...:....:...::.|:...:...:|.:|.|.:|:::....        
 Frog    52 LWKPDSNEHIMKNKEVHFYVNESFIDTVKAELNESSILYMVLVNNAQELIEQQTFND-------- 108

  Fly   132 GRRTKKAARSSMHWKDYHDLETIYSFMREIRTKFPNIVRLYTIGQTAEGRDLKVLRISENPRENK 196
               |.....::..::.||.||.||.:|:.:..|..::::...||.:.|.|.|.||::|...:..|
 Frog   109 ---TSNQRSATSFYEQYHTLEDIYYWMQHMVEKHSDMLQRIHIGYSFENRPLYVLKVSGKEKTAK 170

  Fly   197 -KVWIDGGIHAREWISPATVTFILYQLMSDWE------NQPAHIRGLTWYIMPVMNPDGYEYSRT 254
             .||||.|||||||||||   |.|:.:....|      :....:|.|.:||:||||.|||::|.|
 Frog   171 HAVWIDCGIHAREWISPA---FCLWFVGHAVEYYGVDLSMTKLLRYLDFYILPVMNADGYQFSWT 232

  Fly   255 T-NRLWRKNRSPSRRAQCSGVDLNRNFDIGWNGYGSSTNPCSDTYRGSAPASERETRAVAEFLAK 318
            . ||:||||||...::.|.|.|||||||.||.|.|:|::||.:.|.|....||.|..||..||.|
 Frog   233 AKNRMWRKNRSKYTKSNCIGTDLNRNFDAGWCGPGASSDPCHEIYCGPYAESEPEVSAVVSFLKK 297

  Fly   319 RKYNLESYLTFHSYGQMIVYPWAYKAVKVKDASVLQRVSSLAAERILQKTGTSYRAAVTHEVLGI 383
            .:..::.|:|.|||.||:::|::|...|.||...|..:|...||.|...:...|......|.:.:
 Frog   298 HQNVVKGYITVHSYSQMVLFPYSYTNKKSKDHDELLLLSKKVAEGIRSTSRNKYMYGAGAETIYL 362

  Fly   384 AGGGSDDWSRAALGVKYVYTIELRDRGAYGFVLPPRFIKDTALEGWTVVETVAQAI 439
            |.||||||: ..||:||.:|.||||:|.|||:|||:.||.|..||.|.|:.:|..|
 Frog   363 APGGSDDWA-YDLGIKYSFTFELRDKGMYGFLLPPQLIKPTCSEGITAVKIIAAHI 417

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG3097NP_572259.1 Propep_M14 64..118 CDD:280416 9/51 (18%)
M14_CP_A-B_like 148..439 CDD:199844 132/299 (44%)
cpb2NP_001025617.1 Propep_M14 28..104 CDD:308061 9/52 (17%)
M14_CPB2 118..418 CDD:199868 133/305 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C70963812
eggNOG 1 0.900 E1_COG2866
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 242 1.000 Inparanoid score I3099
OMA 1 1.010
OrthoDB 1 1.010 D208397at33208
OrthoFinder 1 1.000 FOG0000073
OrthoInspector 1 1.000 T129333
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
87.900

Return to query results.
Submit another query.