DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG3097 and Cpa3

Sequence 1:NP_572259.1 Gene:CG3097 FlyBaseID:FBgn0029804 Length:445 Species:Drosophila melanogaster
Sequence 2:NP_062173.1 Gene:Cpa3 RGDID:2390 Length:417 Species:Rattus norvegicus

Alignment Length:442 Identity:134/443 (30%)
Similarity:224/443 (51%) Gaps:40/443 (9%)


  Fly     8 LQLLLLVAAVAASLANELPSNLTLLDANEIPQRYDEAQLWRIYNISEAMQKRVPVGQMLEQKFGG 72
            ::..||:..:.::||             ..|.::|..:::|:....|   |:..:.:.|.|....
  Rat     1 MRSFLLMGVIYSTLA-------------IAPVQFDREKVFRVKLQDE---KQASILKNLTQTIEL 49

  Fly    73 NIWKEN-------SKFLDISIARDQLKAARSFLSAHRLDPQILSHNIQSMIDEELLEGIQSSSFG 130
            :.|..:       :..:|..:...:.:..:|.|..|::|.:||.:::|..||::.          
  Rat    50 DFWYPDAIHDIAVNMTVDFRVTEKESQTIQSTLEQHKMDYEILINDLQEEIDKQF---------- 104

  Fly   131 HGRRTKKAARSSMHWKDYHDLETIYSFMREIRTKFPNIVRLYTIGQTAEGRDLKVLRISENPREN 195
             ..:.:.|.|.|  :..|:|...|.|:..::..|.|.:|....||.|.|...|.||:|.....|.
  Rat   105 -DVKEEIAGRHS--YAKYNDWNKIVSWTEKMVEKHPEMVSRIKIGSTVEDNPLYVLKIGRKDGER 166

  Fly   196 KKVWIDGGIHAREWISPATVTFILYQLMSDWENQPAHIR---GLTWYIMPVMNPDGYEYSRTTNR 257
            |.:::|.|||||||:|||...:.:||....:.......:   .:.:|::||.|.|||.:|.|.:|
  Rat   167 KAIFMDCGIHAREWVSPAFCQWFVYQAAKSYGKNKIMTKLLDRMNFYVLPVFNVDGYIWSWTKDR 231

  Fly   258 LWRKNRSPSRRAQCSGVDLNRNFDIGWNGYGSSTNPCSDTYRGSAPASERETRAVAEFLAKRKYN 322
            :||||||.:..:.|.|.|||||||:.|:...::.|||...|||.||.||:||:||..|:.....:
  Rat   232 MWRKNRSKNPNSTCIGTDLNRNFDVSWDSSPNTDNPCLSVYRGPAPESEKETKAVTNFIRSHLNS 296

  Fly   323 LESYLTFHSYGQMIVYPWAYKAVKVKDASVLQRVSSLAAERILQKTGTSYRAAVTHEVLGIAGGG 387
            :::|:|||||.||:::|:.|......:...|.:|:.:|.:.:..:..|.|........:....|.
  Rat   297 IKAYITFHSYSQMLLFPYGYTIKLPPNHQDLLKVARIATDVLSSRYETRYIYGPIASTIYKTSGS 361

  Fly   388 SDDWSRAALGVKYVYTIELRDRGAYGFVLPPRFIKDTALEGWTVVETVAQAI 439
            |.||: ..||:|:.:..||||:|..||:||...||.|..|....|:.:|:.|
  Rat   362 SLDWA-YDLGIKHTFAFELRDKGKSGFLLPESRIKPTCKETMLSVKFIAKYI 412

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG3097NP_572259.1 Propep_M14 64..118 CDD:280416 13/61 (21%)
M14_CP_A-B_like 148..439 CDD:199844 108/294 (37%)
Cpa3NP_062173.1 Propep_M14 28..102 CDD:280416 16/77 (21%)
Peptidase_M14_like 114..413 CDD:299699 110/303 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C69477456
eggNOG 1 0.900 E1_COG2866
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D208397at33208
OrthoFinder 1 1.000 FOG0000073
OrthoInspector 1 1.000 T131305
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.645 Consistency score
TreeFam 00.000 Not matched by this tool.
76.750

Return to query results.
Submit another query.